KEGG   Rhizobium phaseoli: AMC79_CH00594Help
Entry
AMC79_CH00594     CDS       T04590                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00071  Fatty acid degradation
rpha00072  Synthesis and degradation of ketone bodies
rpha00280  Valine, leucine and isoleucine degradation
rpha00310  Lysine degradation
rpha00362  Benzoate degradation
rpha00380  Tryptophan metabolism
rpha00620  Pyruvate metabolism
rpha00630  Glyoxylate and dicarboxylate metabolism
rpha00640  Propanoate metabolism
rpha00650  Butanoate metabolism
rpha00900  Terpenoid backbone biosynthesis
rpha01100  Metabolic pathways
rpha01110  Biosynthesis of secondary metabolites
rpha01120  Microbial metabolism in diverse environments
rpha01130  Biosynthesis of antibiotics
rpha01200  Carbon metabolism
rpha01212  Fatty acid metabolism
rpha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMC79_CH00594 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    AMC79_CH00594 (fadA)
   00640 Propanoate metabolism
    AMC79_CH00594 (fadA)
   00650 Butanoate metabolism
    AMC79_CH00594 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    AMC79_CH00594 (fadA)
   00072 Synthesis and degradation of ketone bodies
    AMC79_CH00594 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMC79_CH00594 (fadA)
   00310 Lysine degradation
    AMC79_CH00594 (fadA)
   00380 Tryptophan metabolism
    AMC79_CH00594 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMC79_CH00594 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMC79_CH00594 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMC79_CH00594 (fadA)
Enzymes [BR:rpha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMC79_CH00594 (fadA)
Exosome [BR:rpha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMC79_CH00594 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ANL96434
Position
606813..608021
Genome map
AA seq 402 aa AA seqDB search
MTEVFIYDHVRTPRGRGKKDGALHEVPSVRLAAKTLEAIRDRNGLDTRTVDDIIMGCVDP
VMDAGAVIPKAAAFEAGYSTKAPGMQISRFCASGLDAVNFGAGKIAQGADDIVIAGGVES
MSRVGLGMSGGAWFMDPSVNFPAYFMPQGVSADLIATKYGFSRTDVDAYAVESQKRAGHA
WEQGWFDKSVIPVKDQNGLTILDKDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVGIQA
HPEIERINYVHHAGNSSGIVDGAGVVLLGSKAGGESMGMKPRARIKAFANIGSDPALMLT
GPVDVTEKLLKRTGMRLADIDLFELNEAFAAVVLRYMQAFDIDHDRINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATVIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggttttcatttacgaccacgtccgcacgccgcgcggccgcggcaagaaggat
ggcgccctgcatgaggtgccgtccgttcgcctggcggccaagacgctggaagcgattcgc
gaccgcaacgggctcgacacgcgaacggtcgacgacatcatcatgggctgcgtcgatcct
gtcatggatgccggcgccgtcatccccaaggccgccgccttcgaagccggatattcgacg
aaggcgccgggcatgcagatctcccgcttctgcgcctccggcctcgacgccgtcaatttc
ggcgccggcaagattgcccagggtgccgacgacatcgtcattgcgggcggcgtcgaaagc
atgtcgcgcgttggtctcggcatgtccggcggtgcctggttcatggacccctcggtgaat
ttcccggcctatttcatgccgcagggcgtctcggccgatctcatcgccaccaaatacggc
ttcagcagaaccgatgtcgacgcctatgccgtcgagagccagaagcgcgccggacatgcc
tgggaacagggctggttcgacaagtcggtcatccccgtcaaggatcagaacggcctgacg
atcctcgacaaggacgagcacatgcgtccgggcaccgacatgcaggcgctcgcctcgctc
aacccgtccttccagatgccgggtgagatgggcggcttcgaagccgtcggcatccaggcc
catcccgagatcgagcgtatcaactatgtccaccatgccggcaattcctccggcatcgtc
gatggcgccggcgtcgtcctgctcggctcgaaggccggcggcgagagcatggggatgaag
ccgcgcgcccgcatcaaggccttcgccaatatcggctccgatccggccctgatgctgacc
gggcccgtcgacgtcaccgaaaagctgttgaagcggaccggcatgcgccttgccgatatc
gacctcttcgaactcaatgaggccttcgccgctgtcgtgctgcgctacatgcaggccttc
gacatcgaccacgacaggatcaacgtcaatggcggcgccatcgccatgggccacccgctc
ggcgccaccggcgcgatgattctcggcacggtgctcgacgagctcgaacggcgcgatctc
aataccgcgctggtgacgctctgcatcggcgccggcatgggcacggcaacggtaatcgaa
cgcgtttga

DBGET integrated database retrieval system