KEGG   Rhizobium phaseoli: AMC79_CH00830Help
Entry
AMC79_CH00830     CDS       T04590                                 

Definition
(GenBank) phosphate ABC transporter permease protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rpha  Rhizobium phaseoli
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AMC79_CH00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANL96664
Position
complement(854368..855873)
Genome map
AA seq 501 aa AA seqDB search
MPPRPAVLTKRTLDKDLAKITHAEDVAKHVLRRLVAPGLGLIFVGLTMIFAGVYVFDRPG
AVLIVAAAALAGYMAMNIGANDVTNNVGAAVGARAMTMGQALVIAAVFEVLGATIGGGEV
VKTISSNIVDAVQVPQAMLGWIMMAALMAAALWINLATWMNAPVSTTHAIVGAVIGAGIS
AVGTEPVNWRVMLEITSSWITSPLIGGLIAAGLLYLVKTLIIYRDDKVAAARRWVPVLVA
VMAGGFMAYMVLQLSPVGRFPSLTIILIGIGLGLVTWLAARPLVFAQARDLENRNSSLRV
LFRLPLIGSAALLSFAHGANDVSNAVGPLSAIVHSVGIGIGSDGSVGHPPLWVMLIGAFG
ISVGLLLFGPRLIRLVGEEITKLNPMRAYCVALSTAFTVIVASWLGLPVSTTHIAVGAVF
GVGFFREWYTRRSKRRIAYIRRKAESFDIDEPEEPNIHERRRRYLVRRSHFMTIVAAWIV
TVPVSATLAAAIYWAMFALFV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccgccccgtcccgccgtcctcaccaaacgcacgctcgacaaggatctcgccaagatt
acccatgccgaggatgtggcaaagcacgtcttgcggcggctggtggcgcctggcctcggg
ctgatcttcgtcggcctgacgatgatctttgccggtgtctacgtgttcgaccgcccggga
gcggtgcttatcgtggcggccgccgcccttgccggctacatggcgatgaatatcggcgcc
aacgacgtgaccaacaatgtcggtgcggccgtcggcgcacgcgccatgacgatgggccag
gcgctcgtcatcgccgcggttttcgaagtcctcggcgccacgatcggcggcggcgaggtc
gtcaagacgatttcctccaacatcgtcgacgccgtccaggtgccgcaggcgatgcttggc
tggatcatgatggcggcgctgatggcggcggccctctggatcaatcttgccacctggatg
aacgcgccggtttccaccacccatgcgatcgtcggcgcagtgatcggcgccggtatttca
gccgtcggcacggagccggtgaattggcgggtgatgctggagatcacctcgagctggatc
acctcgccgctgatcggagggctgatcgcggctggcctgctctacctcgtcaagaccctc
atcatctatcgcgacgacaaggtcgcggcggcccggcgctgggtgccggtgctggtcgcg
gtgatggccggcggcttcatggcctatatggtgctgcagctgtcacccgtcggccggttt
ccgtctttgaccatcatccttatcggcatcggcctcgggctggtcacgtggcttgccgcc
cggccgctcgttttcgcccaggcgcgggatctcgaaaaccgcaacagctcgctgcgggtg
ctgtttcggctgccgctgatcggctcggcggcgctgctgtccttcgcacatggcgcaaac
gatgtttcgaacgcggtcgggccgctttcggcgatcgtccattcggtcggcatcggcatc
ggcagcgacggcagcgtcgggcatccgccgctctgggtgatgctgatcggcgccttcggc
atctccgtcgggctgctgctgttcggaccgcggctgatccgcctggtcggcgaggagatc
accaagctcaatccgatgcgggcctattgcgtcgcattgtcgaccgctttcaccgtcatc
gtcgcctcctggctcggcctgccggtcagcaccacgcatatcgccgtcggcgccgtcttc
ggcgtcggcttcttccgcgaatggtatacccgccgttcgaagcgccgtatcgcctatatc
aggcgcaaggccgagagcttcgatatcgacgagccggaagagccgaacatccacgagagg
cgccggcgttatctcgtgcgccgctcgcatttcatgacgatcgtcgccgcctggatcgtc
accgtgccggtctccgcaacgcttgcggccgcaatttattgggctatgttcgcgctcttc
gtctag

DBGET integrated database retrieval system