KEGG   Rhizobium phaseoli: AMC79_CH01762Help
Entry
AMC79_CH01762     CDS       T04590                                 

Definition
(GenBank) alpha/beta hydrolase family protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00903  Limonene and pinene degradation
rpha00930  Caprolactam degradation
rpha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMC79_CH01762
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AMC79_CH01762
Enzymes [BR:rpha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     AMC79_CH01762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase DUF434
Motif
Other DBs
NCBI-ProteinID: ANL97566
Position
1773047..1774084
Genome map
AA seq 345 aa AA seqDB search
MKGRTLPNRRAPTRLGYLFPALAALLLSVSAAPGQDIGPQSQGSRAQVEKLLGLWKEHFA
GADSLQERRTAFERLMQTMPGPTRIQVRQVDADGVDAELMWPARLHHPIGERVILYIHGG
GFSGGSIRTHGLFAGSLAKAASSDVLLINYRLMPEYGYPAQINDAVTAYRWLLDNGYRND
NVVVAGDGAGGNIALETVLRQIQAGKALPAAVIALSPITDLAATGGSMTSNAESDPLVGK
DWIETLRKAYLGRKSPTDPQASPLYADLTGFPPLLLQVGSGEALLDDTLRLADKARQAGV
DVTAEIWPGMPHQWQLFPALLDDADRSSQTIAEFAIRHFADKPQE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagggtcggactttgccaaatcgaagagcgcccacgcggctcggatatctgtttccc
gccttggcggcgctgctgctatcggtgtcggcagcgccgggacaggacatcgggccgcaa
agccagggctcgcgtgcgcaggtcgaaaaactgctcggtctctggaaggaacattttgcc
ggcgccgacagcctgcaggagcggcggacagccttcgagcggctgatgcagacgatgccg
ggaccgacacgcatccaggtccggcaggtcgatgccgacggtgtcgatgccgagttgatg
tggcccgcccggcttcatcacccgatcggtgagagggtaatcctctatattcatggtggc
ggcttttccggcggctccatccgcacccacgggctgttcgccggctcgctcgccaaggca
gcatccagcgacgtactgctgatcaattatcggctgatgccggaatatggctatcccgcc
cagatcaacgatgccgtgacggcctaccgctggcttctcgataacggctatcgcaacgac
aatgtcgtcgtggcaggcgacggtgccggcggcaatatcgcgctcgagacggtgctgcgg
caaatacaggccggaaaggcgctgccggcggccgtcattgcgctcagccccatcaccgat
cttgccgcgacgggcggatcgatgacatcgaatgccgaaagcgatccgctggtcggcaaa
gactggatcgagactttgcgcaaggcctatctcggccgaaagtccccgaccgatccccag
gcatctccgctctatgccgacctgacgggctttccgccgctattgctgcaggtcggctcc
ggcgaggccctgctggacgacacgctgcgccttgccgacaaggcgcgtcaggcgggagtt
gatgtcaccgccgaaatctggccgggcatgccgcatcaatggcagctgtttcccgctctg
ctcgacgatgccgaccgttccagccagactatcgccgagtttgcgatccggcattttgcg
gacaaaccgcaggagtag

DBGET integrated database retrieval system