KEGG   Rhizobium phaseoli: AMC79_CH02625Help
Entry
AMC79_CH02625     CDS       T04590                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00860  Porphyrin and chlorophyll metabolism
rpha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMC79_CH02625 (cobQ)
Enzymes [BR:rpha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AMC79_CH02625 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA BPL_N
Motif
Other DBs
NCBI-ProteinID: ANL98404
Position
complement(2659497..2660951)
Genome map
AA seq 484 aa AA seqDB search
MARAIMLQGTGSDVGKTVMVAGLCRLAANRGLTVRPFKPQNMSNNAAVADDGGEIGRAQW
LQSLAARTPSSVHMNPVLLKPQLENGSQIIVQGRVFGQAKGRDYQRLKPQLLGAVLASFE
KVADGADLVIVEGAGSPAEINLRAGDIANMGFATQAGVPVVLVGDIDRGGVIASLVGTHA
ILADADRAMISGYIINKFRGDVSLFDNGIRAIEGFTGWPCFGVVPWLSGAARLPAEDSVV
LERLAKGGGGALKIAVPLLPRIANFDDLDPLRAEPDVELVFVRSGERLPADASLIVLPGS
KSTISDLADFRARGWDRDLEMHVRRGGRVIGICGGYQMLGRTVHDPLGLEGGTLATPGLA
LLDVETEMAPEKTVRNSHARSTEYDAPLAGYQIHLGMTRGPDCGRPSAIVDGVPDGALSV
NGLIMGTYLHGLFASDAYRTRLLQSFGLSGERRNYRESVDKALDEIAGELERYLDPRWLA
GLVG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagcgatcatgctgcagggaaccggctcggatgtcggcaagacggtgatggtc
gccgggctctgccggctggcggccaatcgcgggctaaccgtgcggccgttcaagccgcag
aatatgtcgaacaatgcggcggtcgccgacgatggcggcgaaatcggccgggcgcagtgg
ctgcagtcgcttgccgcccgcacgccgtcctcggtgcacatgaacccggtgcttctgaag
ccgcaattggaaaacggcagccagatcatcgtgcagggcagggtgttcgggcaggccaaa
ggccgggattaccagcggctgaagccgcagttgctcggcgcagtgctcgcaagcttcgag
aaagtggccgacggcgccgatctcgtcatcgtcgagggggcgggatcgccggccgagatc
aatctgagagctggcgatatcgccaatatgggctttgcgacgcaggcaggcgtgccggtc
gtgctcgtcggcgatatcgatcgcggcggtgtcatcgcctcgctggtcggcacgcatgca
attctggcagacgccgatcgggcgatgatctcgggctatatcatcaacaagtttcgcggc
gacgtttcgctgttcgataacggcatccgcgccatcgaaggcttcaccggctggccgtgc
ttcggcgtcgtgccctggctttcaggcgccgcacgtctgccggccgaggattccgtcgtg
ctcgaacgtctggcaaagggtggcgggggcgcgctgaagatcgccgtgccgctattaccg
cgcatcgccaattttgacgatctcgacccgttgagggcggagccggatgtcgagctggtc
ttcgtgcgatcaggcgagcggctgcctgccgatgcgagcctgatcgtccttcccggctcg
aaatcgacgatatcggatcttgccgacttcagggctcggggctgggaccgcgatctcgag
atgcatgtccgccgcggcggccgggtgattggcatttgcggcggctatcagatgctcggc
cgcaccgtgcatgatccgctcgggctcgagggcgggacgcttgcgacgccggggcttgcg
ctgctcgacgtcgagaccgagatggcgccggagaagacggtgcgcaacagccatgcgcgc
tcgaccgaatatgatgcaccgcttgccggctaccagatccacctcggcatgacgcgcggc
ccggattgcggccggccttcggcaatcgtcgacggcgtgcccgacggggcgctctcggtc
aatggcctgattatgggtacctatctccacgggctgtttgccagtgacgcctaccgcact
cggctgcttcaaagcttcggactgtccggtgagcgaaggaattaccgcgaaagcgtcgat
aaggcactcgacgagatcgccggagaactggaacgttacctcgacccgcgctggttggcc
gggctggtaggttag

DBGET integrated database retrieval system