KEGG   Rhizobium phaseoli: AMC79_CH04062Help
Entry
AMC79_CH04062     CDS       T04590                                 

Gene name
arcB
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rpha  Rhizobium phaseoli
Pathway
rpha00220  Arginine biosynthesis
rpha00330  Arginine and proline metabolism
rpha01100  Metabolic pathways
rpha01110  Biosynthesis of secondary metabolites
rpha01130  Biosynthesis of antibiotics
rpha01230  Biosynthesis of amino acids
Module
rpha_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rpha00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AMC79_CH04062 (arcB)
   00330 Arginine and proline metabolism
    AMC79_CH04062 (arcB)
Enzymes [BR:rpha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AMC79_CH04062 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ANL99792
UniProt: A0A2U3CTD0
Position
4149075..4150010
Genome map
AA seq 311 aa AA seqDB search
MNVQSRSVTLIGAPLEEGSGRRGAAMGPAALRIAGVDQTLIDLGHDVADNGDLRIVPAMD
LPNHPKAHNLRTVGAFTRALESSVYDVAASGRFPLILGGDHSLSMGSVSGMARYAADKGR
PLFVLWLDAHADFNSPATSPSGNIHGMPVAFFCGEAEFAEILPKDRPFVDPKHVFQVGIR
SVDAREREEIHEHGVNVFDMRAIDEQGIAAIMRYILDVVAKANGLLHVSLDLDFLDPDIA
PGVGTTVPGGATFREAHLVMEMLSDSGLVSSLDLVELNPFLDDRGKSARILVELTASLFG
RRIFDRPTRAA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccaatcgcgatctgtcaccctcatcggcgctccattggaggaaggctccggc
cgcagaggtgctgccatgggccccgcggcgctgcgcatcgccggcgtcgaccagacgctg
atcgatctcggccacgatgtcgcggataacggcgatctcaggatcgtaccggcgatggac
cttccgaatcatcccaaggcccataatctgagaaccgtcggcgccttcactcgcgctctc
gaaagcagcgtctatgatgtcgccgcctccggccgctttccgctcattctcggcggcgac
cacagcctttccatgggcagcgtctccggcatggcccgttatgccgccgacaagggtcgc
ccgctcttcgtgctctggctcgatgcccatgccgatttcaattctccggccacctccccc
tccggcaatattcacggcatgcccgtcgccttcttctgcggcgaggcggagttcgccgag
atcctgccgaaggaccgtcccttcgtcgatccgaaacatgtcttccaggtcggcatccgc
tcggtcgatgcgcgcgagcgcgaagaaatccacgaacacggtgtcaacgtcttcgatatg
cgcgcgatcgacgaacagggcatcgccgctatcatgcggtatattctcgatgtcgtcgcc
aaggccaacggcctgctgcatgtcagcctcgatctggatttcctcgatcccgatattgcc
cccggcgtcggcacgacggtgcccggcggcgcgaccttccgcgaggcccatctggtcatg
gaaatgctgtccgacagcggtctcgtctcgtcgctcgatctcgtcgagctcaatccgttt
ctcgacgatcgtggcaagagcgcccggatattggtggaactgacggcaagtctcttcggc
cgccgcattttcgatcgtccaacccgtgccgcatag

DBGET integrated database retrieval system