KEGG   Ralstonia pickettii 12J: Rpic_0039Help
Entry
Rpic_0039         CDS       T00762                                 

Definition
(GenBank) Diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00300  Lysine biosynthesis
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01230  Biosynthesis of amino acids
Module
rpi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rpic_0039
Enzymes [BR:rpi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Rpic_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: ACD25204
UniProt: B2UD25
Position
1:51188..52066
Genome map
AA seq 292 aa AA seqDB search
MKLHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGADQLLLVERSTRPDVDF
RYRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNGIATLTMQDDGQVTVDM
GAPVFEAARLPFLPEGLPTRTQGDDTQHALQINGRTEWLSTVSMGNPHAVQIVDDTEAFP
VLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGETLACGTGACAAVVAGIRR
GLLDSPVKVATHGGDLTIAWAGDGQPVMMTGPATTVFEGTLDLDALKLTAAH
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcacttcaccaagatgcacggcgcgggcaacgactttgtcgtgctcgacggc
atccagaccccgatcgacttcacgcccgagcaatgggctgccattgccgaccgccacttc
ggcgtgggggcggaccagctcctgctggtcgagcgttcgacacggcccgatgtcgacttc
cgttaccgcatcttcaaccacgacggcggcgaggtggagcactgcggtaacggcgcacgt
tgcttcgtcaagttcgtcaccgaccgcggtttgaccgacaaacgcaccgtgcgtgtggaa
gtcatgaacggcatcgccacgctgacgatgcaggacgacggccaggtcacagtcgacatg
ggcgcaccggtgttcgaggcggcgcgcctgccgttcctgcctgaaggcctgcccacccgc
acccaaggcgacgacacgcagcacgcgctgcagatcaacggccggaccgaatggctgtcg
accgtgtcgatgggcaatccgcacgccgtgcagattgtcgacgatacggaagccttcccc
gtgctggaagatggcccgctgatcgaatcgcatgccgtgtttccgcgtcgcgtgaatgcg
ggcttcatgcagatcgtcgatcgccattccgtgcgcctgcgcgtgtacgagcgcggcgcg
ggggagacgctcgcctgtggcaccggcgcgtgcgcagcggtggtggccggcatccgccgc
ggcctgctcgattcacccgtcaaggtggccacgcacggcggcgacctgaccatcgcgtgg
gcgggcgatggccagccggtcatgatgacgggccccgccacgaccgtgtttgaaggcacg
ctggatctggatgcgctcaagctgaccgctgcccactag

DBGET integrated database retrieval system