KEGG   Ralstonia pickettii 12J: Rpic_0109Help
Entry
Rpic_0109         CDS       T00762                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00061  Fatty acid biosynthesis
rpi00071  Fatty acid degradation
rpi01100  Metabolic pathways
rpi01212  Fatty acid metabolism
rpi02024  Quorum sensing
Module
rpi_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Rpic_0109
   00071 Fatty acid degradation
    Rpic_0109
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_0109
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rpi01004]
    Rpic_0109
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpi04147]
    Rpic_0109
Enzymes [BR:rpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Rpic_0109
Lipid biosynthesis proteins [BR:rpi01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Rpic_0109
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Rpic_0109
  Exosomal proteins of breast cancer cells
   Rpic_0109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACD25272
UniProt: B2UD93
Position
1:128330..129916
Genome map
AA seq 528 aa AA seqDB search
MSEATPDTALEANLLNRVTLGDTLHRSARKFGAKVALVDGARRMTHGELNADSNRYAHAL
LASSLKPGDKVAMVCGNSAQFLVAAYGILKAGLVWVPINAMLGPEDVRYILEHAEARHVV
IDAALYPALRDTLATLGLPAHQCFGEPVADGPQPVEQALQGHADTLPAVVIDDRDLALIM
YTSGTTGRPKGAMHSHRSVHAALMSNVAGLNLNETDVFSCLLPMFHCAQFATAASAMMVG
ATLVIQRGFDPAALLDVIANERITQLFGLPLMYAALLHHPLRAQRDLSSLRLCLYAMAPM
ARPLLERLIAEVCPNFALGSGQTEIFPMTMYFAPDQQLQRTGNYWGQPCMVNEAAVMDDQ
GNLLGPNQLGEIVHRGPNVMLGYYKDPQATANARRFGWHHTGDLGMWDADGQLQFKDRIK
DMIKTGGENVPSVKVEEVLLRHPAVANAAVVGLPHAHWVEAVAAFVCLKPDAHADAAALQ
AHCRAHLGSFEVPKHIAVVDKLPMTATGKIQKHVLRSANQTLFEGEAR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagccacgccagacaccgcgcttgaagccaacctgctgaaccgggtgacgttg
ggcgatacgttgcatcgcagtgcgcgcaagttcggcgcgaaggtcgcgctggtcgatggc
gcccgccgcatgacgcatggcgaactcaacgcagacagcaatcgctacgcgcacgcgctg
cttgcaagcagcctcaagcccggcgacaaggtggcgatggtgtgtggaaactctgcgcag
ttcctggtggccgcgtacggcattctcaaggcgggactggtgtgggtgccgatcaacgcg
atgctcgggccggaagacgtgcgctacatcctcgaacatgccgaggcgcggcacgtggtg
atcgacgcggcgctgtacccggcgctgcgcgacacgctggcgacgctcgggctcccggcg
caccaatgcttcggtgaaccggttgccgacgggccgcaaccggtggagcaagcgctgcaa
ggccacgcggacacgctgcccgctgtggtgatcgacgatcgcgatctcgcgctcatcatg
tacaccagcggcacgaccggccgaccaaagggcgcgatgcattcgcaccgctcggtgcat
gccgcgctgatgtccaacgtcgccggcctgaatctgaatgagaccgacgtgttctcgtgc
ctgctgccgatgttccactgcgcgcagtttgcaacggccgcgtccgcgatgatggtgggc
gccacgcttgtcatccagcgcggctttgatccggcggcgctgctcgatgtgattgccaac
gaacgcatcacgcagctgttcggcttgccgctcatgtacgccgcgctgctgcatcatccg
ctgcgtgcgcagcgcgatctctcaagcctgcgcctgtgcctctatgcgatggcgccgatg
gccaggcccctgctcgaacgcctgattgccgaggtgtgccccaactttgccctcggctcc
gggcagaccgaaatttttccgatgacgatgtacttcgcgcctgaccagcaactgcagcgc
accggcaactattgggggcagccgtgcatggtgaacgaagcagcggtgatggacgatcaa
ggcaatctgctcggcccgaaccagttgggcgagatcgtgcaccgcggcccgaacgtcatg
ctcggctactacaaggacccgcaggccacggccaatgcgcgccgcttcggctggcaccac
acgggcgacctcggcatgtgggatgccgacggccagcttcagttcaaggaccgcatcaag
gacatgatcaagaccggcggcgagaacgtcccttcggtcaaggtggaagaagtgttgcta
cggcacccggccgtggcgaatgcggcagtggtcggcttgccgcacgcgcactgggtggaa
gcggtggccgcattcgtctgcctcaagcccgatgctcacgccgatgccgccgcgttgcag
gcgcattgtcgggcgcatctcggcagctttgaggtgcccaagcacatcgccgtggtcgac
aagctgcccatgacggcgaccggcaagatccagaaacacgtgctgcgcagcgccaaccag
acgctgttcgagggcgaggcccgctaa

DBGET integrated database retrieval system