KEGG   Ralstonia pickettii 12J: Rpic_0414Help
Entry
Rpic_0414         CDS       T00762                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00071  Fatty acid degradation
rpi00072  Synthesis and degradation of ketone bodies
rpi00280  Valine, leucine and isoleucine degradation
rpi00310  Lysine degradation
rpi00362  Benzoate degradation
rpi00380  Tryptophan metabolism
rpi00620  Pyruvate metabolism
rpi00630  Glyoxylate and dicarboxylate metabolism
rpi00640  Propanoate metabolism
rpi00650  Butanoate metabolism
rpi00900  Terpenoid backbone biosynthesis
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01200  Carbon metabolism
rpi01212  Fatty acid metabolism
rpi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rpic_0414
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic_0414
   00640 Propanoate metabolism
    Rpic_0414
   00650 Butanoate metabolism
    Rpic_0414
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rpic_0414
   00072 Synthesis and degradation of ketone bodies
    Rpic_0414
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rpic_0414
   00310 Lysine degradation
    Rpic_0414
   00380 Tryptophan metabolism
    Rpic_0414
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rpic_0414
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rpic_0414
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rpic_0414
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpi04147]
    Rpic_0414
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rpic_0414
Exosome [BR:rpi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rpic_0414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACD25572
UniProt: B2UFP9
Position
1:complement(441729..443048)
Genome map
AA seq 439 aa AA seqDB search
MLVNAQLRRVAILGGNRIPFARSNTAYATASNQQMLTAALQGLIDRFNLHGQRLDEVVAG
AVIKHARDFNLTRETVLSTTLAKQTPAYDIQQACGTGLEAAILVANKIALGQIDVGIAGG
TDTTSDAPVGLNEKMRKILLEANRAKSTGARVKALAGLRPSMFVRPLLPRNSEPRTGLSM
GEHCELMAKRWGIRREDQDALALRSHHNLTAAYERGFFTDLMTAHLGLDRDNNLRSNLTI
EQLAKLQPVFDRSAAGTMTAGNSTPLTDGASCVLLASEDWARAHNLPVLAYMTCADTAAV
DFFSSTPEQNEGLLMAPAYAVSRMLQRAGLTLQDFDYYEIHEAFAAQVLSTLAAWESPEY
CREKLGRSAPMGSIDRSKLNVNGSSLGTGHPFAATGGRIVATLAKMLAQRGSGRGLVSIC
AAGGQGVVAILERPETMSH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtcaacgcgcagttgcgccgcgtcgccatccttggcggtaaccgcattccgttc
gcccgctcgaatacggcctacgctaccgcatcgaaccagcagatgctgaccgccgcgctg
cagggcctgatcgaccgcttcaacctgcacggccagcgtctggacgaagtcgtggccggc
gcggtcatcaagcacgcgcgcgatttcaacctgacgcgcgaaacggtgctctccaccacg
ctcgccaagcagacgcccgcttacgacatccagcaggcctgcggcacggggctggaagcc
gccattctcgttgccaacaagattgcactggggcagatcgacgtgggcattgccggcggc
acggacaccacctccgatgcgcccgtcggcctgaacgaaaagatgcgcaagatcctgctg
gaggccaaccgcgccaagtccacaggcgcgcgcgtcaaagcgctggccggcctgcggccg
tcgatgttcgtgcgcccgctgctgccgcgcaacagcgagccgcgcaccggcctgtcgatg
ggcgaacactgcgagctgatggccaagcgctggggcatccgccgcgaagaccaggacgcg
ctggccctgcgcagccaccacaacctcacggccgcctacgagcggggcttcttcaccgac
ctgatgaccgcccacctggggctcgatcgcgacaacaacctgcgcagcaacttgaccatc
gagcaactggcgaagctgcagccggtattcgaccgcagcgccgccggcaccatgacggcc
ggcaactccacgccgctcaccgatggcgcatcgtgcgtactgctcgccagcgaagactgg
gcgcgcgcgcacaacctgcccgtgctcgcctacatgacctgcgcggatacggctgccgtc
gatttcttcagcagcacgccggagcagaacgaagggctgctgatggcgccggcctatgcc
gtctcgcgcatgctgcaacgcgcggggctcaccctgcaggacttcgactactacgagatc
cacgaagcctttgccgcacaggtgctcagcacgctggcggcctgggaatcgcctgaatac
tgccgcgaaaagctcggccgcagcgcccccatgggcagcatcgaccgtagcaagctgaac
gtgaatggcagctcgcttggcacgggccatccgtttgccgccacgggcgggcgcattgtc
gcgacgctggccaagatgctggcgcagcgcggcagcgggcgtgggctggtgtcgatctgt
gccgctggcggccaaggtgtcgttgccattctggagcgccccgaaacgatgtcgcactaa

DBGET integrated database retrieval system