KEGG   Ralstonia pickettii 12J: Rpic_0542Help
Entry
Rpic_0542         CDS       T00762                                 

Definition
(GenBank) isocitrate lyase and phosphorylmutase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00630  Glyoxylate and dicarboxylate metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01200  Carbon metabolism
Module
rpi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rpic_0542
Enzymes [BR:rpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rpic_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACD25697
UniProt: B2U6J3
Position
1:580184..581770
Genome map
AA seq 528 aa AA seqDB search
MAQYQDDIKAVAGLKETHGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDANAKAAIQAKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQYNAFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVKEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMKEAGKDVSAYERGQLMSTEYDDSE
LAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQFH
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtatcaagacgacatcaaggcagttgccggtttgaaagagacccacggcagc
gcatggaatgcgatcaaccccgagtacgctgcccgcatgcgtgcccagaacaagttcaag
acgggtctggacatcgccaagtacaccgccaagatcatgcgcgcggacatggctgcctac
gacgccgatccgtccaagtacacgcagtcgctcggttgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgagcgccgctacctgtatctg
tcgggctggatggtcgctgcgctgcgctccgagttcggcccgctgccggaccagtcgatg
cacgagaagacttcggtcagcgcgctgattcgcgagctgtacaccttcctgcgccaggcc
gatgcacgtgaactgggcggtctgttccgcgagctggatgctgccaaggacgctaacgct
aaggccgccatccaggcaaagatcgacaaccacgtcacgcacgtcgtgcccatcattgcc
gacatcgacgctggtttcggcaacgcagaagccacgtacctgctggccaagcagttcatc
gaagcgggtgcctgctgtatccagatcgaaaatcaggtgtcggacgagaagcagtgcggc
caccaggatggcaaggtcaccgtgccgcatgaggacttcctcgccaagatccgcgcgatc
cgctacgcgttcctggagctgggtgtggacgacggcatcatcgtggcccgtaccgactcg
ctgggcgcaggcctcaccaagcagatcgccgtgaccaacacgccgggcgacctgggcgac
cagtacaacgcgttcctcgactgcgaagaactgtcggccgaccaactgggcaacggtgac
gtcgtcatcaagcgcgacggcaagctgctgcgcccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgctgcgtgctcgattgcatcacctcgctgcaa
aacggtgccgacctgctgtggatcgaaaccgaaaagccgcacatcgcgcagatcggcggc
atggtcaaggaaatccgcaaggtcatcccgaacgccaagttggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgccagcaggtgtatgacgcgatgaaggaagccggc
aaggatgtgtcggcctacgagcgcggccaactgatgagcacggagtacgacgacagcgaa
ctggcaaagctcgccgacgagaagatccgcacgttccaggccgatgcatcgcgtgaagcc
ggcatcttccaccacctgatcacgctgccgacgtaccacactgccgcgctgtcgaccgac
aacctggccaaggaatacttcggcgaccagggcatgctcggttatgtggccggcgtgcag
cgcaaggaaatccgccaaggcatcgcctgcgtcaagcaccagaacatgtcgggctcggac
atcggtgacgaccacaaggaatacttcagcggcgaagcggcactgaaggctgcgggtaag
gacaacaccatgaaccagttccactga

DBGET integrated database retrieval system