KEGG   Ralstonia pickettii 12J: Rpic_0564Help
Entry
Rpic_0564         CDS       T00762                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
rpi  Ralstonia pickettii 12J
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic_0564
Enzymes [BR:rpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Rpic_0564
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Rpic_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA SBD_N NBD_C
Motif
Other DBs
NCBI-ProteinID: ACD25716
UniProt: B2U6L2
Position
1:complement(598044..600356)
Genome map
AA seq 770 aa AA seqDB search
MNTSAHTAPKLLILADDLSGAADCAVAGVRAGLRSAVMLRADVGHPIGYPTSADVLALDT
DTRRANAVDAAATQVAAWHALARPATRLYKKIDSTLRGNVAAEVAALAPLAGLAIVAPAF
PAAGRTTRDGRQWLHGVAVEDTEVWRNESIGGRADLRVMLERQGLQTAVLTLDDIRAGAA
ALAGRLAALQADGVQAVVCDAQTDDDLAHIAETSVRLAHVFWVGSAGLAPALIRAAGLGS
ANAAVEGDAATAIAGPVLTVVGSMSSVSHAQASELKAAAGARLLSLELPVEELDTPQADI
TQTVIDALCEGRDVLVTLSQTTRGNSADGLHFCRRLATLLAPALPHAGGLIATGGETARA
VLSTAGIDALRLCDEIESGMPLLHAQLTGVGGVLPVVTKAGGFGTPGSLHAAWRRLIETA
ASTPPKGTHAMTYRPVIGITMGDAAGVGPEIIMKALTHRAVYEQCRPLVIGDTARLRDAA
QRTGAALEVRSIERPADAAFRYGVVDCIDLGLIPADLPYGKLSPIAGDAAYQYIARTVEL
TSAGELDAICTAPLNKEALHAGGHIFPGHTEMLAHLTGIDEVSMMLVAPNLRVIHVTTHI
GLLDAIRRIEPGLVQRTIERAHATLVRAGIENPRIGVCGINPHAGENGLFGHGEEEQKII
PAVQVLQARGWRVEGPLPADTLFFRAGRGDFDVVVAMYHDQGHGPVKVMGLEAGVNVTVG
LPVIRTSVDHGTAFDIAGKGIADERSMLEAFRQACELATRHDDPQAVRAA
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacgtccgcccacaccgctccgaagctgctgatcctggccgacgacctgtcgggc
gccgccgattgcgcggtggccggcgtgcgggccggattgcgcagcgcggtcatgctgcgc
gccgatgttggacaccccatcgggtatccgaccagcgccgacgtcctcgcactggacacc
gacacgcggcgcgccaatgccgtcgatgcggcggccacgcaggtggcggcatggcatgca
ctggcccggccggccacgcggctctacaagaagatcgattcgaccctgcgcggcaacgtc
gctgctgaggtggccgcgcttgcaccgctggcgggtctggccatcgtggcgccggcgttt
ccggcagccggacgcaccacccgcgacggccgccagtggctgcacggcgtggccgtggaa
gacaccgaggtgtggcgcaacgaaagcatcggcggccgcgccgatctgcgcgtcatgttg
gagcgccaaggccttcagaccgccgtgctgacgcttgacgacatccgcgccggtgccgcc
gcgctggccggtcgcctggcggcactacaggcggacggtgtgcaagccgtggtgtgcgac
gcccagaccgatgacgacctcgcgcacatcgccgagacctccgtgcggctggcgcatgtg
ttctgggtcggctccgccggtctggcgcccgcgctgattcgcgcggcggggctcggcagc
gccaacgccgctgtcgaaggcgatgcggcaaccgcaatcgccgggccggtgctgacggtg
gtgggcagcatgtccagcgtgtcccatgcgcaggcgtcggaattgaaggccgctgccggt
gcgcgcctgctgtcgctggagctgcccgtggaagagctcgacacaccgcaggcggacatc
acccagaccgtcatcgatgcgctgtgcgaaggccgcgacgtgctggtcacgctcagccaa
accacgcgcggcaacagcgccgacggcctgcacttctgccgccgcctcgccacgttgctg
gcgccggctttgccgcatgccggcgggctgatcgccaccggcggcgagaccgcgcgcgcc
gtgctgtcgaccgccggcatcgacgcgctgcgcctgtgcgacgaaatcgaatccggcatg
ccgctgctgcatgcccaacttactggcgtcggcggcgtgctgccggtcgtcaccaaggcg
gggggcttcggcacacccggctccctgcatgccgcttggcgacggttgatcgaaaccgca
gccagcaccccacccaaaggaactcacgcaatgacctatcgtcctgtcatcggcatcacc
atgggcgatgccgccggtgtcggccccgagatcatcatgaaggcgctcacacaccgcgcg
gtgtacgagcaatgccgacctctggtgattggcgacacggcacgactgcgcgatgccgcc
caacgtaccggcgcggcactggaagttcgctcgatcgagcgccctgccgacgccgccttc
cgctacggcgtagtggactgcatcgacctcggcctcattcctgccgacctgccctacggc
aagctctctcccatcgcgggcgatgccgcgtatcagtacatcgcccgcaccgtcgagctg
acgtccgctggcgaactggatgccatctgtaccgcgccgctgaacaaggaagcgctgcac
gccggcggccacatcttcccgggccacaccgaaatgctggcgcacctgaccggcatcgat
gaggtttcgatgatgctcgtggcgcccaacctgcgcgtgatccacgtgacgacccatatc
gggctgctagacgccatccgccgcatcgagccgggcctggtccagcgcaccatcgaacgc
gcgcacgccacgctggtacgcgccggcatcgagaacccgcgcatcggtgtctgcggcatc
aacccgcatgcgggagaaaacgggctgttcggccatggcgaagaagagcaaaagatcatc
cccgccgtgcaggtgctgcaggcacgcggctggcgcgtagagggcccgctgcccgccgac
acgctgttcttccgcgccggccgtggcgacttcgatgtggtggtggcgatgtatcacgac
cagggccacggaccggtcaaggtgatgggcctggaagccggtgtgaacgtcaccgtgggc
ctgccggtaatccgtacttcggtcgaccatggaaccgcgttcgacattgccggcaagggc
atcgccgatgaacgcagcatgctcgaagcgtttcgccaggcctgtgaactcgccacccga
cacgatgacccgcaagccgtacgtgcggcctga

DBGET integrated database retrieval system