KEGG   Ralstonia pickettii 12J: Rpic_0754Help
Entry
Rpic_0754         CDS       T00762                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00260  Glycine, serine and threonine metabolism
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01120  Microbial metabolism in diverse environments
rpi01130  Biosynthesis of antibiotics
rpi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rpic_0754
Enzymes [BR:rpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Rpic_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACD25905
UniProt: B2U863
Position
1:793711..794757
Genome map
AA seq 348 aa AA seqDB search
MQPKQHFASDNYAGFCPESLKYFLEANGSGHEPAYGDDLWTQRVCDRIRDLFETDCEVFF
VFNGTAANSLALSSLCQSYHSVICHELAHIETDECGGPEFFSNGSKLLTAKGENGKLTPD
AVEALVTRRSDIHYPKPKVVSLTQSTEVGTVYTVDEVRAIAAIAKRRQLRVHMDGARFAN
AVASLGVHPSEITWRAGVDVLCFGGTKNGLPVGEAVVFFDRRLAEDFAYRVKQAGQLASK
MRFISAPWLGLLENDVWLRNARHGNAMAQLLHARIADVPGVRIMFPTESNAVFAELPVPA
IEALRARGWRFYTFIGAGGCRLMCSWDVQPETVEAFAADIRAACAQAV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccaagcagcatttcgcctcagacaactacgcgggcttctgcccggagtcgctg
aagtatttcctggaggccaacggcagcggccatgagccggcctatggcgatgatttgtgg
acgcagcgcgtgtgcgaccgcattcgcgacctgttcgagacggattgcgaagtcttcttt
gtcttcaacggcacggccgccaattcgctggcgctttcgtcgctatgccagtcgtatcac
tccgtgatctgccacgagctggcgcacatcgaaaccgacgaatgcggcggcccggagttc
ttctccaacggctccaagctgctgaccgccaagggcgagaacggcaagctcacgccggat
gcggtcgaagcgctcgtcacgcggcgctccgatatccactacccgaaaccgaaagtggtt
tcgctgacgcaatcgaccgaagtcggcaccgtctataccgtggacgaggtccgcgcgatt
gccgcgattgccaagcgtcgccagttgcgcgtgcatatggacggcgcgcgttttgcgaat
gcggtggcgtcgctcggcgtgcatccgtcggagattacctggcgcgccggcgtggatgtg
ctgtgctttggcggcacgaagaacggtctgccggtcggcgaggccgtggtcttcttcgat
cgccgcctggcggaagactttgcatatcgcgtcaagcaggccgggcagttggcgtcgaag
atgcgtttcatctcggcgccgtggctgggtctgctcgagaacgatgtgtggctgcgcaac
gcgcgtcacggcaatgcgatggcgcaactgctgcatgcgcgcattgccgatgtgccgggc
gtgcgcatcatgttcccgaccgaatcgaacgccgtgttcgccgagcttccggtgccggcc
atcgaggcgttgcgcgcacgcggctggcgcttctacacgttcattggtgcgggcggctgc
cgcctgatgtgctcgtgggacgtgcaaccggagacggtggaagcctttgccgccgatatt
cgcgcagcctgcgcgcaggccgtttaa

DBGET integrated database retrieval system