KEGG   Ralstonia pickettii 12J: Rpic_1930Help
Entry
Rpic_1930         CDS       T00762                                 

Definition
(GenBank) leucyl/phenylalanyl-tRNA/protein transferase
  KO
K00684  leucyl/phenylalanyl-tRNA---protein transferase [EC:2.3.2.6]
Organism
rpi  Ralstonia pickettii 12J
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rpic_1930
Enzymes [BR:rpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.6  lysine/arginine leucyltransferase
     Rpic_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Leu_Phe_trans Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: ACD27065
UniProt: B2UFW4
Position
1:2037508..2038254
Genome map
AA seq 248 aa AA seqDB search
MIAWLDPHDPFPPVDRALGPESEAPGLLAASAELSPQRLLIAYRQGIFPWYAQGQPVLWW
STDPRMVLRPEDFRVSTTFRKTLRRVLDDPAWEIRIDHAFRETMVACATTARPGQHGTWI
TEDVIQAYTALHRRGYAHSVETWHAGQRVGGLYGVALGRMFYGESMFAHRTDASKIALAA
LCAFLGGQGVAMIDCQQETEHLASLGGAPVPRAAFLAHVREAASAPAIVPWHFDKSVLRR
WTVRNEQA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctggctggatccgcacgatcccttcccgccggtcgatcgcgcgctcgggccg
gagtccgaagcgcccggcctgctggccgccagcgctgagctatcgccgcaacggctgctg
attgcgtatcgacaaggcatttttccgtggtatgcccagggccagccggtgttgtggtgg
agcaccgatccacgcatggtgctccgccccgaagactttcgcgtatcaaccacgtttcgc
aagacgctgcgccgcgtgcttgacgacccggcctgggaaatccgcatcgaccacgccttc
cgcgaaacgatggtcgcgtgcgccaccacagcgcgccctggacagcacggcacgtggatc
accgaagacgtcatccaggcgtacacagccctgcaccgccgcggctacgcgcacagcgtg
gagacgtggcacgccgggcaacgtgtgggtggcctgtacggcgtggcgcttggccgcatg
ttctacggtgaatcgatgtttgcgcatcgcaccgatgcctcgaaaatcgcgctggcagcg
ctctgcgccttcctcggcggtcagggcgtcgcgatgatagactgccagcaggaaaccgag
catctggcgtcgctgggcggtgccccggtgccgcgcgcggcgtttctcgcacatgtgcgc
gaagcggccagcgcgccggccattgtgccgtggcacttcgacaaatcggtgctccgccgg
tggaccgtacgcaatgagcaagcttaa

DBGET integrated database retrieval system