KEGG   Ralstonia pickettii 12J: Rpic_2207Help
Entry
Rpic_2207         CDS       T00762                                 

Definition
(GenBank) NADH dehydrogenase (quinone)
  KO
K00337  NADH-quinone oxidoreductase subunit H [EC:7.1.1.2]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00190  Oxidative phosphorylation
rpi01100  Metabolic pathways
Module
rpi_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Rpic_2207
Enzymes [BR:rpi01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     Rpic_2207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NADHdh
Motif
Other DBs
NCBI-ProteinID: ACD27341
UniProt: B2U7Q4
Position
1:complement(2316501..2317565)
Genome map
AA seq 354 aa AA seqDB search
MIESITSFGTATFGGWWPLVWTLVRAVCIILPLLLCVAYLILWERKLIGWMHVRLGPNRV
GPMGLLQPIADVLKLLLKEVMVPSAVSRGMYIIAPLMVLMPAVAIWAVIPFQAEAMVSNI
NAGLLYVMAISSVGVYGVILAGWASNSKYAFLGAMRASAQMISYEIAMGFALVTVLMVTG
SLNLSDIVNSQNRGFFAGHGINILSWNWLPLLPMFGVYFISGVAETNRHPFDVVEGESEI
VAGHMIEYSGMAFALFFLAEYINMIVISALTATLFLGGWASPIDAPVLNWIPGFFWLLIK
VFLLLSVFIWLRASFPRYRYDQIMRLGWKIFIPLTVGWLVVVAIWLVSPWNIWK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtcgattacttctttcggtaccgccaccttcggtggctggtggccgctggtc
tggacgctggtccgtgcggtctgcatcattctgccgctgctgctgtgcgtggcttacctg
atcctgtgggagcgcaagctcatcggctggatgcacgtgcgtctgggcccgaaccgcgtg
ggcccgatgggcctgctgcagccgattgccgacgtgctcaagctgctgctcaaggaagtc
atggtgccgagcgcggtcagccgtggcatgtacatcatcgcgccgctgatggtgctgatg
cccgccgtggcgatctgggcggtgattccgttccaggccgaggcgatggtgtcgaacatc
aacgctggcctgctgtacgtgatggcgatcagctcggtgggcgtatacggcgtgattctg
gcgggctgggcttcgaactcgaagtacgcgttcctgggtgcgatgcgtgcttcggcacaa
atgatttcgtacgaaatcgccatgggcttcgcgctcgtgaccgtgctgatggtaacgggc
agcctgaacctgtcggacatcgtcaactcgcagaaccgcggtttctttgcaggtcacggt
atcaacatcctgtcgtggaactggctgccgctgctgccgatgttcggcgtctacttcatc
tcgggtgtagctgaaacgaaccgccatccgtttgacgtggtggaaggtgaatccgaaatc
gtggccggccacatgatcgaatactcgggcatggcgttcgcgctgttcttcctggccgag
tacatcaacatgatcgtgatctcggcgctgacggcgacgctgttcctgggcggctgggct
tcgccgatcgacgcaccggtcctcaactggattccgggcttcttctggctgctgatcaag
gttttcctgctgctgtcggtcttcatctggctgcgtgcatcgttcccgcgttatcgctat
gaccagatcatgcgtctgggctggaagatcttcattccgctcactgtgggctggcttgtc
gtcgtcgccatctggttggtgtcgccgtggaacatctggaagtaa

DBGET integrated database retrieval system