KEGG   Ralstonia pickettii 12J: Rpic_2594Help
Entry
Rpic_2594         CDS       T00762                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00450  Selenocompound metabolism
rpi00970  Aminoacyl-tRNA biosynthesis
rpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rpic_2594
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rpic_2594
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpi01007]
    Rpic_2594
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpi03016]
    Rpic_2594
Enzymes [BR:rpi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Rpic_2594
Amino acid related enzymes [BR:rpi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Rpic_2594
Transfer RNA biogenesis [BR:rpi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Rpic_2594
 Prokaryotic type
   Other AARSs
    Rpic_2594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACD27721
UniProt: B2UA27
Position
1:2704334..2706466
Genome map
AA seq 710 aa AA seqDB search
MRLSARRALFAARPHLSGLPMSERRILVTSALPYANGPIHIGHLVEYIQTDIWVRFQRMR
GHETYYVGADDTHGTPVMLRAEKEGLTPRQLIERVWTEHKRDFDNFLVSFDNYYSTDSDE
NKELCQNVYLKLKEAGLIDVREVEQFYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEVC
GATYQPTDLKNPYSVVSGATPVRKSSEHYFFKLSDPRCENFLRDWVADLAQPEATNKMRE
WLGEEGEAKLSDWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLCAKRGLDFD
AWINEHSTTEQYHFIGKDILYFHTLFWPAMLKFSGHRTPTNVFAHGFLTVDGAKMSKSRG
TFITAQSYIDTGLNPEWLRYYFAAKLNATMEDLDLNLDDFIARVNSDLVGKFVNIASRSA
GFLVKRFEGRVSDAALGHPLMVQLREAAPQIADLYEKREYSKALRAVMELADAVNAFVDT
EKPWDLAKDEANREKLHAACSVALEAFRLLAVYLKPILPTTVERIEAFLNVEPLTWRSID
SQLSSDKPIQPYSHLMTRVDKKQVDALVEANRQSLQATAEAPAAAAANGAAAIEPMADTI
TIDDFAKIDLRVAKIVACQRVEGSNKLLQLTLDVGEGQTRNVFSGIQSAYAPEDLVGKLT
VMVANLAPRKMKFGMSEGMVLAASAADEKAQPGLYILEPHSGAVPGMRVR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttatccgcgcgccgcgccctgttcgcggcccgcccgcacctttctggcctgccc
atgtccgaacgtcgcatcctcgtcacttccgccctgccttatgccaacgggccgatccat
atcggccacctggtcgagtacatccagaccgatatctgggtacgcttccagcgcatgcgc
ggtcatgagacctactacgtgggtgccgacgacacgcacggcacgcccgtcatgctgcgc
gccgagaaggaaggcctgaccccgcgccagctgatcgaacgcgtctggacggaacataag
cgcgacttcgacaacttcctggtctcgttcgacaactactacagcaccgactccgacgaa
aacaaggagctgtgccaaaacgtctacctcaagctcaaggaagccggcctgatcgacgtg
cgcgaggtcgagcaattctacgacccggtcaaggagatgttcctgccagaccgcttcatc
aaaggcgaatgcccgaagtgcggcgcgaaagaccagtacggcgattcgtgcgaagtctgc
ggcgcaacctaccagccgaccgacctgaagaacccatactccgtggtgtcgggcgcgacc
ccggtgcgcaagtcgtcggaacactacttcttcaagctgtccgacccgcgctgcgagaac
ttcctgcgcgactgggtggccgacctggcccagcccgaagccaccaacaagatgcgtgaa
tggctcggcgaggaaggcgaggccaagctctcggactgggacatctcgcgtgatgcgccg
tacttcggtttcgaaattccgggcgccccgggcaaatacttctacgtgtggctggatgcg
ccggtcggctactacgccagcttcaagaacctgtgcgccaagcgcggcctggatttcgac
gcgtggatcaacgaacactcgaccaccgagcagtaccacttcatcggcaaggacatcctc
tatttccacacgctgttctggccggcgatgctgaagttctccggccaccgcacgccaacc
aacgtgttcgcccacggcttcctgacggtggacggcgcgaagatgagcaagtcgcgcggc
acgttcatcactgcgcaaagctacatcgacaccggcctgaacccagaatggctgcgctac
tacttcgcggccaagctgaacgcgacgatggaagatctggacctgaacctggacgatttc
atcgcccgtgtgaacagtgatctggtgggcaagttcgtcaacatcgccagccgctcggcg
ggcttcctggtcaagcgcttcgaaggccgcgtgagcgacgccgcgctgggccatccgctg
atggtgcaactgcgcgaagccgccccgcaaatcgccgatctgtacgagaagcgcgagtac
agcaaggcactgcgtgccgtcatggaactggccgatgccgtcaacgccttcgtcgacacc
gagaaaccgtgggatctggccaaggatgaagccaaccgcgaaaagctgcacgccgcatgc
tcggtcgcgctggaagcgttccgcctgctggccgtgtacctcaagccgattctgcccacc
acggtcgagcgcatcgaagcgttcctcaacgttgagccgctgacgtggcgttcgatcgat
tcgcagctctcgtcggataagccgatccagccgtactcccacctgatgacgcgcgtggac
aagaagcaggtggatgcgctggtggaggcaaatcgtcagtcgctgcaggccaccgcagaa
gccccggctgctgccgccgccaacggtgctgccgccattgagccgatggccgacaccatc
accatcgacgacttcgccaagatcgacttgcgtgtcgccaagatcgtcgcctgccagcgc
gtggaaggatcgaacaagctgctgcagctgacgctggatgtgggcgaaggacagacgcgg
aatgtgttttcgggtatccagtcggcatatgcgccggaagatctggtgggcaagctgacc
gtgatggttgccaacctggcaccgcgcaagatgaagttcgggatgtcggaagggatggtg
ttggcggcttcggctgccgatgagaaggctcagcctgggctttatattcttgagccgcat
tctggggcggtgccggggatgcgggtgcggtaa

DBGET integrated database retrieval system