KEGG   Ralstonia pickettii 12J: Rpic_2645Help
Entry
Rpic_2645         CDS       T00762                                 

Definition
(GenBank) P-type conjugative transfer ATPase TrbB
  KO
K20527  type IV secretion system protein TrbB [EC:7.4.2.8]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_2645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpi02044]
    Rpic_2645
Enzymes [BR:rpi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Rpic_2645
Secretion system [BR:rpi02044]
 Type IV secretion system
  Trb secretion system protein
   Rpic_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE TrwB_AAD_bind FtsK_SpoIIIE AAA_28 IstB_IS21 AAA_16 Zeta_toxin CbiA MMR_HSR1 AAA_25 AAA_7 ABC_tran ATPase MobB Sigma54_activat AAA_30 TIP49 AAA_19 ResIII AAA_10 DEAD GTP_EFTU CLP1_P AAA_29
Motif
Other DBs
NCBI-ProteinID: ACD27771
UniProt: B2UAH4
Position
1:2759485..2760522
Genome map
AA seq 345 aa AA seqDB search
MSAVPSSFTATSLDRRIQMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWVDRLSTGRAPM
GVELSEADGERIIRLVAAHVGTEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKR
AFGVIPLSRYIEDGMMTAAQAGLLVRAVRERQNILIAGGTSTGKTTLANALLAEIAATGD
RVLVLEDTVELQCAARDHVPLRTRQGVVSMTELVRSSMRLRPDRVIVGEVRGAEALDLIK
VWGTGHPGGIATIHAGSALGALLRLEQLILEVAENPPRALIAEAVNVVIHIAGRGRKRRI
ESIARVVGFDGAGYQLADALEAPFPELLSQSDLSSLSPDQPGELP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgttccttcctccttcacggccacctcgctggatcgccgcatccagatgctg
cgcacggccatggggccgctgatcgctgccgcgctcgaagacccggacgtggtggaaatc
atgctcaaccccgatcgcacgctctgggtggatcgtctgtccacgggccgcgcgccgatg
ggcgtggaactgtccgaggccgatggcgaacgcatcatccgcctcgttgcagctcacgtt
ggcacggaagttcatcggggccagccgttgttgacggcagagctgcccgagacgggcgaa
cgcttcgagggcatcctgccgcccgccgcgccggggccggccttcgccttgcgcaagcgc
gcctttggcgtgatcccactgtcgcgctacatcgaggacggaatgatgaccgccgcgcag
gcgggcctgctggtgcgcgccgtgcgcgagcgccagaacatcctgatcgcaggcggcacc
agcacgggcaagaccacgctcgccaatgccttgctcgccgagattgccgctaccggtgac
cgcgtgctggtgcttgaagacacggtggagctgcaatgcgcggcgcgcgatcacgtaccg
ctgcgcacgcgccagggcgtggtgtcgatgaccgagctggtgcgctcttccatgcgcctg
cgcccggatcgcgtgatcgttggcgaagtgcgtggtgccgaggcgctggatctcatcaag
gtatggggcacgggccaccccggcggcatcgccaccatccacgccggctccgcgctgggc
gcgctgctgcgcctggagcaactgattctcgaagtggcggagaacccgccccgtgcgctg
atcgcggaagcggtcaacgtggtcatccacatcgccgggcgcggacgcaagcgccgcatc
gagagcatcgcccgcgtcgtcggcttcgatggcgcgggctaccaactggcggatgcgctg
gaggctccattcccggagctgctgtcgcagtccgacctttcttccctgtcccctgaccaa
cctggagaactgccatga

DBGET integrated database retrieval system