KEGG   Ralstonia pickettii 12J: Rpic_2651Help
Entry
Rpic_2651         CDS       T00762                                 

Definition
(GenBank) Conjugal transfer protein
  KO
K20531  type IV secretion system protein TrbF
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_2651
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpi02044]
    Rpic_2651
Secretion system [BR:rpi02044]
 Type IV secretion system
  Trb secretion system protein
   Rpic_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8
Motif
Other DBs
NCBI-ProteinID: ACD27777
UniProt: B2UAI0
Position
1:2765825..2766529
Genome map
AA seq 234 aa AA seqDB search
MRFKRPQVRYADTPQPATPYQSAAQVWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLV
WRSAQSIVTPYVIEVDNAGQVRAVGEAATPYRPSDAQIAYHLGRFIGLVRSLSIDPIVVR
QNWLDAYDYTTDKGAVVLNEYARVNDPFARIGKESVTVQITSVTRASDTSFNVRWTETRF
VNGALDRTERWNAVVSIVQQTPRTEQRLRKNPLGIYVNGLSWSRELEGNEGAKP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaaacgaccgcaggtgcgctacgccgacacgccgcagcctgccaccccgtac
caatccgccgcgcaagtctgggacgagcgcatcggctcggcccgcgtgcaggctagaaac
tggcgtttcatggcctttggctgcctcaccttggccgtgctgatggccggtggtctggtc
tggcgctccgcgcaatccatcgtcacgccctacgtcatcgaggtggataacgcgggccag
gtgcgcgcggtcggcgaggccgccacgccgtaccggcccagcgatgcgcagatcgcctac
cacctgggccgcttcatcggcctggtgcgcagcctgtccatcgaccccatcgtggtgcgg
cagaactggctcgatgcctacgactacacgaccgacaagggcgctgttgtgctcaacgag
tacgcccgcgtgaacgatccgttcgcgcgcatcggcaaggagtcagtgacggtgcagatc
accagcgtgacccgcgccagtgacacgtctttcaacgtgcgctggacggagacgcgcttc
gtcaatggcgcgctggatcgcaccgaacgctggaacgccgtggtttccatcgtgcagcag
acgccgcgcaccgagcagcgcctgcgcaagaaccccctgggcatctacgtcaacggcctg
tcgtggagccgcgaactggaaggaaacgaaggagcaaaaccatga

DBGET integrated database retrieval system