KEGG   Ralstonia pickettii 12J: Rpic_2753
Entry
Rpic_2753         CDS       T00762                                 

Definition
(GenBank) hypothetical protein
Organism
rpi  Ralstonia pickettii 12J
SSDB
Motif
Pfam: FAD-SLDH
Other DBs
NCBI-ProteinID: ACD27877
UniProt: B2UB28
Position
1:complement(2865416..2866030)
AA seq 204 aa
MWRMLRCARKVPAGRCVVTAFRTHLIGWGRLSLENASRFCSRPAVSLPSSSPRPTKPAQR
SKPAHFRRRDFVLGCGALLVLGAVPGFRPPSRDASSLDDFMLVSQTISGAPPDRHVGLSC
FSHLHRTDDRFIEHIQTLAWLVRRNPGLDGVGLVRLIDADSACDLRAALARLVDAWSARL
DADPAWGDIRPLIVRASEASLSGS
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtggcgcatgttgcgctgcgcaagaaaggtgcccgccggacgatgcgtcgtgactgcg
tttcggacccatctgattggatgggggcgcctgagccttgaaaatgcgagccgattttgt
tcaaggcccgccgtgtctctgccgtcgtcatctccccgccccaccaagcccgcccagcgc
agcaagcctgcccatttccggcgccgcgattttgttctgggctgcggcgccttacttgtg
ctgggcgccgtgccgggttttcgtccgccttcgcgtgacgcttccagcctcgacgatttc
atgctggtgtcgcagacgatctccggtgccccgccggaccgccacgtgggcctgtcctgt
ttcagccatttgcaccggactgacgatcgcttcatcgaacacatccagacgcttgcgtgg
ctggtcaggcgcaatccgggcctggacggcgttggcctagtccgcttaatcgatgccgac
agcgcgtgcgacctgcgcgccgccttggcccgccttgtggatgcctggagcgcccggctg
gatgcggatcccgcgtggggggacatccgcccgctcatcgtcagggcttctgaggccagc
ctgtcaggcagttga

DBGET integrated database retrieval system