KEGG   Ralstonia pickettii 12J: Rpic_3127Help
Entry
Rpic_3127         CDS       T00762                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpi01100  Metabolic pathways
rpi01110  Biosynthesis of secondary metabolites
rpi01130  Biosynthesis of antibiotics
rpi01230  Biosynthesis of amino acids
Module
rpi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rpic_3127
Enzymes [BR:rpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rpic_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACD28250
UniProt: B2UDK9
Position
1:3275200..3276003
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKAEEVAAARKHRDLPSVRAEAEANRSDSTLRARGFARAMRDKIAAGNAA
VIAEVKKASPSKGVLRPNFKPADIARSYAEHGAACLSVLTDEQFFQGHADYLREARAACT
LPVLRKDFMVDLYQVYEARSWGADCILLIVAALDQGLMEELEACALELGMDVLVEVHDGH
ELDRALRLQTPLVGVNNRNLRTFETTLDTTLGLLKHMPDDRIVVTESGILTPDDVRKMRA
AAVNAFLVGEAFMRADDPGAELARLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctccagaaaatcctggccgtgaaggccgaagaagtggccgccgcgcgc
aagcaccgagacctgcccagcgtgcgcgccgaagccgaagccaaccgcagcgacagcacg
ctcagggcccgcggctttgccagggcaatgcgcgacaagatcgccgccggcaacgcagcg
gtcatcgccgaagtgaaaaaggcgtcgccgtccaaaggtgtgctgcgcccgaacttcaag
ccagccgacatcgcccgcagctatgccgagcacggcgccgcgtgtctgtccgtcctgacc
gacgaacagttcttccagggccacgccgattacctgcgcgaggcgcgcgccgcctgcacg
ctgccggtgctgcgcaaggatttcatggtcgatctgtatcaggtgtacgaagcgcgctcg
tggggtgcggactgcatcctgctgatcgtcgccgcgctggaccagggcctgatggaagaa
ctcgaagcgtgcgcgctggaactcggcatggacgtgctcgtggaagtgcacgacggccat
gagctggaccgcgcgctgcgcctgcaaacaccgctggtgggtgtgaacaaccgcaacctg
cgcacgttcgaaaccacgctcgacaccacgctcggcctgctcaagcacatgccggacgat
cgcatcgtcgtcacggaatccggcatcctcacgccggacgatgtgcgcaagatgcgcgcc
gcagccgtcaacgcgttcctcgtcggcgaagccttcatgcgtgcagacgacccgggcgcc
gaactggcccgcctgtttgcctga

DBGET integrated database retrieval system