KEGG   Ralstonia pickettii 12J: Rpic_5008Help
Entry
Rpic_5008         CDS       T00762                                 

Definition
(GenBank) Conjugal transfer protein TrbG/VirB9/CagX
  KO
K20532  type IV secretion system protein TrbG
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_5008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpi02044]
    Rpic_5008
Secretion system [BR:rpi02044]
 Type IV secretion system
  Trb secretion system protein
   Rpic_5008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACD30089
UniProt: B2UKI8
Position
pRPIC01:complement(55802..56755)
Genome map
AA seq 317 aa AA seqDB search
MKTLPRAILIIAAMATHAASVYADVPAAAPRPQGEFGRMSKVAPAARAASPCAKSSAFGP
FAEQQDPTLATYAYDADYTYPIPMRPNQQTHLVLGDDETLVSFTLGDRNKKLWPTMPSVT
KRDLFIVPAAAGQRAAATIITSKRRYELQLCSGDDGPAYQRVSWQYTDTLADGVGASPTA
FGFEMAATPGVPGRPEAGGSKTGSPRIDATRMNTNYRIEGNAEFKPVMVFDDGRMTYYQL
PHDAKLSAVFILDKDGQGEMARVIPLGNDMYQIQEVVTYGALLKRGKDEVRIFNGKGSGC
GFFSCDTKPVKNIDGGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctacctcgcgccattctcatcattgctgcgatggcaacgcatgccgcatcg
gtctatgccgatgtccctgcagccgctcctcgcccccagggcgagttcggccgcatgtcg
aaggttgcgccggcagctcgcgcggcgtcgccctgcgccaagtcttctgctttcggcccc
tttgctgagcagcaagacccgacgcttgcgacctacgcctacgacgcggattacacatat
ccgattccgatgcggcccaatcagcagacgcacctggtgctgggtgacgacgagacgttg
gtgtcgttcacgctcggcgaccgaaacaagaagctctggccaacgatgccatcggtcacc
aagcgcgacctcttcatcgtgccggctgcagctggacagcgcgcggccgcgacgatcatc
acgtcgaaacgacgctacgagcttcaactgtgctcgggtgacgacggcccggcatatcaa
cgtgtgagttggcaatacacagacacgttggccgatggtgtcggcgcgagcccgacggca
ttcggtttcgagatggcggctacgcctggtgtaccaggtcgcccagaagcgggaggctcg
aaaacggggagcccgcgcatcgacgcgacgcgcatgaacacgaactaccgcatcgagggc
aacgccgagttcaagccggtgatggtgttcgacgatggccgcatgacgtattaccaactg
ccgcacgacgccaagctgtcggccgtgttcatcctggacaaggatggccagggtgaaatg
gcgcgcgtgattccgctcggcaacgacatgtaccagatccaggaggttgtcacgtacggc
gcgctgctcaagcgaggcaaggacgaggtgcggatcttcaatggcaaggggtcaggctgt
ggtttcttcagctgcgatactaagcctgtgaagaacatcgatgggggcgcttga

DBGET integrated database retrieval system