KEGG   Ralstonia pickettii 12J: Rpic_5013Help
Entry
Rpic_5013         CDS       T00762                                 

Definition
(GenBank) Type IV secretory pathway VirB4 protein-like protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_5013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpi02044]
    Rpic_5013
Enzymes [BR:rpi01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Rpic_5013
Secretion system [BR:rpi02044]
 Type IV secretion system
  Trb secretion system protein
   Rpic_5013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagE_TrbE_VirB FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ACD30094
UniProt: B2UKJ3
Position
pRPIC01:complement(59773..62451)
Genome map
AA seq 892 aa AA seqDB search
MLNNPTLSPFDRESLTQIEERLAGRRRSTAELVPWLFKYSDFMIANKDSALMVSFEFTAP
DSNSISMTVMRELYEHVAASLGNLSRYPISLWWTVHRRLDSRYVTLPMPDKVAQMVDDDR
HANFLAEGNYVNRHFVTFSLLPQVGLDAFASRVMHGVTHDDLSIPSALWEAVRATFSDQY
QFAYTQSELEAAVETFESILHGFAADNPHIKMRRLAGKRLGGFMHAVCSPPSDHITELDI
PETPALDQAMCDTEITPGHDYLHFYSNGRQRYGIATGIPGKRDYWPSNASPKTLDDLLKI
KGELTISHCFRVSSPSAAKRFIDSIRKYHEGQRFDVRQLLAATLRGTDMDAKPGRQNKTR
LKAAEEANTRAGKVEMLEEIYGFYNFTVIAYSPVFEETPASKGLAGEQAYKKAVATHNAV
EDVLRAAQFIPVRETLHAMSAFATTIPGMWRECARWAFLDTEAVSRLLPLRGVSRGSMFN
AHLSKQMRTRIPALAAFTTEYGTPFWFTAYLMDLGHMLICGRSGFGKTIFMLLCATLFRK
YPNARLIGFDMNLSMRIPTVLQGGRYLQFAADANTVAEEERATCNPYVLLGHLRHLKFLV
DWTVLLASQRGYRPTTDDRKAIEKAIRAAATRDPQFWRLRFVHASLPNGPLKNELDQWVG
EAVDALYFDNEQDGFDDTQWTSIATDKILKDHAVARPFLSYATYRIQDEIEQRRLRGVIA
PTVVMLPEIWSLLDDNQFAKQIGEWIVTMRKLLGCVWMDAQTPEQVANSPIWPAIRDNVL
IRVFVPVKDFKPDTKKAYEEKFGLTQTQQDAIKKLKAKRDYFITEDGGISRSVSVPLPPR
TEAILRSELQAQILFDRHMRSGEPDWKERYIEEATAQIEADKLNLDDEDRHA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaacaaccctacgctctcgccgttcgaccgagaatcgcttacacagatcgaggaa
cgcctagcaggccggaggcgatcgaccgctgagctcgtgccgtggctattcaagtacagc
gatttcatgatcgccaacaaggattcagccttgatggtgtcctttgaattcacggcacct
gattccaacagcatttccatgacggtgatgcgtgaactttacgagcacgtcgccgccagc
ctgggcaacctgtcgcgctatcctatctcgctctggtggacggtccatcggcgcttggat
tcgcgctatgtcaccctgcccatgccggacaaggttgcgcagatggtcgacgacgatcgg
cacgcgaatttcttggccgaaggcaactacgtcaaccggcatttcgtcacgttctcgctt
cttccccaggtcgggctcgacgcattcgcctcgcgcgtcatgcatggcgttacgcatgac
gacctgtcgatcccgagcgcgctctgggaggccgtgcgtgccacgttttccgaccagtac
cagttcgcctacacgcagtccgaactggaggctgctgttgaaacctttgaatctatcctg
cacggcttcgctgcagacaacccgcacatcaaaatgcggcgtctggccggcaagcgcctc
ggcggatttatgcacgcggtctgctccccgccaagcgatcacatcactgaactggacatc
ccggaaacgccggcactcgaccaggcgatgtgcgacacggaaattacgccgggccacgac
tacctgcacttctactcgaacgggcgccagcgatacggcattgcaacggggattccgggg
aagcgggactactggccaagcaatgcgtcgccaaagactctggacgacctcctgaagatc
aagggtgagctcaccatcagccattgcttccgtgtgtcgtcacccagcgcagcaaagcgt
ttcatcgacagtatccgcaagtaccacgaaggccagcgcttcgatgtgcgccagctgctc
gcggcgaccctgcgcgggactgatatggacgccaagccagggcgccagaacaaaacgcgc
ctgaaggccgccgaagaggcgaacacacgcgccggcaaggtcgaaatgcttgaggagatc
tacggcttctacaacttcaccgtcattgcgtactcgcccgtgttcgaggaaacgccggcc
tcgaagggtcttgccggcgagcaggcctacaagaaagccgtggcgacacacaacgccgtg
gaagacgttctgcgcgcagcccagttcataccggtgcgcgagactctgcacgccatgtcg
gcgtttgcgaccaccattccgggtatgtggcgcgagtgcgcgcgctgggcgtttctcgac
accgaagccgtttcccgcttgctgccgctgcgcggcgtctcgcgcggctcaatgttcaat
gcgcatctgtccaagcagatgcgcacacggattccggcgctggcggcgtttaccaccgaa
tacggtacgcctttctggtttaccgcctacctgatggaccttggccacatgctcatctgt
ggccgctcgggcttcggcaagaccatcttcatgttgctgtgcgcgacactgttccggaaa
tatccgaacgcgcggctgatcggcttcgacatgaatttgtcgatgcgcattccgactgtc
ctgcagggtgggcgctatctgcaatttgcggccgatgccaacaccgtggccgaagaggag
cgggcaacctgcaatccctatgtcctgctgggtcatctccgccatctcaagttcctagtc
gactggaccgtgctgctggccagccagcgaggctatcggcccaccacggacgatcgaaaa
gccatcgagaaggcgatacgcgcagctgctacgcgcgaccctcaattctggcgtctgcgg
ttcgtgcacgcctccctgcccaatggcccgctgaaaaacgagcttgaccagtgggtgggc
gaggcggtcgacgcgctctacttcgataacgaacaagacggtttcgacgacacgcagtgg
acctcgattgcaacggacaagatcctcaaggatcacgccgttgcgcgcccgttcctctcc
tacgcgacctaccgtattcaggacgaaatcgagcaacgccggttgcgcggggtcatcgcg
ccaaccgtcgtcatgctcccggaaatctggtcgctgctcgatgacaaccagttcgccaag
cagatcggtgaatggatcgtgaccatgcgcaagctgctcggttgcgtttggatggacgca
cagacccccgaacaagtcgccaactcaccgatttggcccgccatccgcgacaacgttctg
atccgcgtcttcgtgcccgtcaaggatttcaagccggataccaagaaggcctacgaggaa
aagtttggtctcacgcagacccagcaggacgcgatcaagaagctcaaggccaagcgcgac
tacttcattaccgaggacggcgggatctcccgcagcgtctcagttcccctgcctccgcgc
acggaggccatcctgcgctccgaactgcaggcgcagatcctcttcgatcggcatatgcgt
tccggtgagccggactggaaggagcgctacatcgaggaggccactgcacagatcgaagcc
gacaaactcaacctagacgatgaggaccgccatgcataa

DBGET integrated database retrieval system