KEGG   Ralstonia pickettii 12J: Rpic_5014Help
Entry
Rpic_5014         CDS       T00762                                 

Definition
(GenBank) type IV secretory pathway VirB3 family protein
  KO
K20529  type IV secretion system protein TrbD
Organism
rpi  Ralstonia pickettii 12J
Pathway
rpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rpi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rpic_5014
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpi02044]
    Rpic_5014
Secretion system [BR:rpi02044]
 Type IV secretion system
  Trb secretion system protein
   Rpic_5014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB3
Motif
Other DBs
NCBI-ProteinID: ACD30095
UniProt: B2UKJ4
Position
pRPIC01:complement(62445..62801)
Genome map
AA seq 118 aa AA seqDB search
MTTAIEAGTPAADTPADSLSVPIRKTMLEKFLMGGIDRKLCAGELAILIFTAVGLRNPWV
LLALPPTHLILWLATKRDPDQFNCYLRYSKQGDFYEPRPMLRQTRNARPKGFARGELC
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgatcgaagccggcacgccggcggcggatacgcccgccgactccctgtcc
gtgcccatccgcaagaccatgctcgaaaagttcctgatggggggcattgacaggaagctc
tgcgccggcgagctcgccatcctcatattcaccgccgtaggcctgcgcaatccgtgggtc
ctgctggcgcttccgccgacgcatctgatcctgtggctcgcgacgaaacgcgatcctgac
caattcaactgctatttgcgctacagcaaacagggcgacttctacgagccgcggccgatg
cttcgccagacacgtaatgctcgccccaagggcttcgcgcgaggtgaactgtgctga

DBGET integrated database retrieval system