KEGG   Ralstonia pickettii DTP0602: N234_12960Help
Entry
N234_12960        CDS       T03172                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00620  Pyruvate metabolism
rpj00630  Glyoxylate and dicarboxylate metabolism
rpj01100  Metabolic pathways
rpj01110  Biosynthesis of secondary metabolites
rpj01120  Microbial metabolism in diverse environments
rpj01200  Carbon metabolism
Module
rpj_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N234_12960
   00630 Glyoxylate and dicarboxylate metabolism
    N234_12960
Enzymes [BR:rpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     N234_12960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 17102499
NCBI-ProteinID: AGW90946
UniProt: U3QNW5
Position
1:complement(2791411..2792997)
Genome map
AA seq 528 aa AA seqDB search
MAITLPAGMKITGEILPAYEDILTPEALALVDKLHRAFEPRRQELLAARVARAKRLDAGE
IPDFLPETRNIREGDWKVAPVPKALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSN
TPNWHNQLQGQVNLKAAVRRTLTLESKGKQYKLNDKIATLQVRPRGWHLDEKHVTIDGKR
ISGGIFDFALFLFHNSKEQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMEEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVTM
TAPFMRAYALLLLKTCHQRGAPAIGGMSALIPIKNDPEKNAIAMEGIISDKRRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFEKQRPDVQVKGADLLDFKPETPITEHGLRMNI
NVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKELVGGDTKTYDRAAEIFEQMSTSEDFAEFLTLPLYEEV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacgctgcccgcgggcatgaagattaccggcgaaatcctgccggcctacgaa
gatatcctcacgccggaagccctggccctggtagacaagctgcaccgcgccttcgagccg
cgccgccaggaactgctggccgcacgcgtggcacgcgcaaagcgcctggacgccggcgaa
atccccgacttcctgccggaaaccaggaacatccgcgaaggcgactggaaggtggccccg
gtgcccaaggcgctggaatgccgccgcgtggaaatcaccggtccggtcgaagccaagatg
gtcatcaacgccttcaactcgggcgctgacagctacatgaccgacttcgaggattccaac
accccgaactggcacaaccagctgcaaggccaggtcaacctgaaggccgccgtgcgccgc
acgctgaccctggaatccaagggcaagcagtacaagctgaacgacaagatcgccacgctg
caggtgcgtccgcgcggctggcacctggatgaaaagcacgtcaccatcgacggcaagcgc
atctcgggcggcatcttcgacttcgcgctgttcctgttccacaactccaaggagcagatc
gcccgcggcgccggcccgttcttctacctgcccaagatggaaagccatctggaggcgcgt
ctgtggaacgacattttcgtgatggcgcagaacgagatcggcctgccgcaaggcaccatc
aaggccaccgtgctgatcgagaccatcctggccgcgttcgagatggaagagatcctgtat
gaactgcgcgagcacagcgctggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagaacgacaaggacttctgcctggccgaccgtgccaaggtcaccatg
accgcgccgttcatgcgtgcctatgcgctgctgctgctcaagacctgccaccagcgcggc
gctcccgccatcggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggaaggcatcatcagcgacaagcgccgcgatgccaccgacggctacgac
ggcggctgggtggcccacccgggcctggtcgagccggcgatgaaggaattcgtcgcggtg
ctgggcgacaagcccaaccagttcgagaagcaacgcccggacgtgcaggtgaagggcgcg
gacctgctcgacttcaagccggaaacgccgattaccgagcacggcctgcgcatgaacatc
aacgtcggcatccactacctgggcgcctggctggacggcaacggttgcgtgccgatccac
aacctgatggaagacgccgccaccgccgagatttcgcgctcgcaggtgtggcagtggatt
cggtcgccgaagggcaagctggaagacggcaccaaggtgacggctgagctggtgcgcaag
ctgattccggaagagctggccaaggtgaaggaactggttggtggcgataccaagacgtat
gaccgggctgccgagatttttgagcagatgtctacgtcggaggattttgccgagttcctg
acgctgccgttgtatgaggaagtctga

DBGET integrated database retrieval system