KEGG   Ralstonia pickettii DTP0602: N234_20545Help
Entry
N234_20545        CDS       T03172                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00790  Folate biosynthesis
rpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    N234_20545
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpj04147]
    N234_20545
Enzymes [BR:rpj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     N234_20545
Exosome [BR:rpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N234_20545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 17104017
NCBI-ProteinID: AGW92422
UniProt: U3QWI2
Position
1:4413334..4413717
Genome map
AA seq 127 aa AA seqDB search
MPAATARAGRLSAFLRTSFSYDQIEPSMTPLSPQARATLLADLPGWTPVQDRDAIFKRFT
FHDFNAAFGFMTRVAIQAEKADHHPEWFNVYNRVDITLSTHDANGLTQRDIDLAHFIERA
AAAVAQD
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgccacggcgcgggcgggccggctgtccgcatttttgcggacttcgttttcc
tacgaccagatcgagccctctatgacccctctttctccgcaagcacgcgccacactgctg
gccgacctgcccggctggacccccgtccaggaccgcgacgcgatcttcaagcgctttacc
ttccacgacttcaacgccgccttcggctttatgacgcgcgtggcgatccaggccgaaaag
gccgaccaccacccggaatggttcaacgtctacaaccgcgtcgatatcacgctgtccacg
catgacgccaacggcctgacgcagcgcgacatcgacctggcgcactttatcgagcgcgcc
gccgccgcggtggcgcaggactga

DBGET integrated database retrieval system