KEGG   Ralstonia pickettii DTP0602: N234_29155Help
Entry
N234_29155        CDS       T03172                                 

Definition
(GenBank) 4-hyroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00360  Phenylalanine metabolism
rpj00362  Benzoate degradation
rpj00621  Dioxin degradation
rpj00622  Xylene degradation
rpj01100  Metabolic pathways
rpj01120  Microbial metabolism in diverse environments
rpj01220  Degradation of aromatic compounds
Module
rpj_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
rpj_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    N234_29155
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N234_29155
   00622 Xylene degradation
    N234_29155
   00621 Dioxin degradation
    N234_29155
Enzymes [BR:rpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     N234_29155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF362
Motif
Other DBs
NCBI-GeneID: 17105730
NCBI-ProteinID: AGW94109
UniProt: U3QT38
Position
2:complement(1761536..1762558)
Genome map
AA seq 340 aa AA seqDB search
MATKLYISDVTLRDGSHAIRHQYSIPQVRAIAKALDEARVDSIEVAHGDGLQGSSFNYGF
GAHTDLEWIAAVAETVTHAKVATLLLPGIGTIHDLRAAYDAGARIVRVATHCTEADISRQ
HIEYARELGMDTVGFLMMSHMTTPQVLAQQARLMESYGATCIYVVDSGGALTMDGVRDRF
RAFKDVLDPVTHTGMHAHHNLSLGVANSLVAVEEGCNRIDASLAGMGAGAGNAPLEVFIA
AAERMGWNHGTDLYKLMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHSEVAAER
YGLKTVDILVELGRRRMVGGQEDMIVDVALDLKSQQNAAG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccaagctctatatctccgacgtgacgctgcgcgacggctcgcacgcaatccgt
caccagtacagcattccgcaggtccgcgcgatcgcgaaggccctggacgaagcccgcgtc
gattcgatcgaggtggcgcacggcgatggcctgcaaggttcatcgttcaactacggcttc
ggcgcgcataccgacctggaatggatcgccgccgtggcggaaaccgtcacccacgccaag
gtggccacgctgctgctgccgggcatcggcaccatccacgacctgcgcgccgcctatgac
gccggcgcccgcatcgtgcgcgtggcgacgcattgcaccgaagccgacatctcgcgccag
catatcgagtacgcccgcgagctcggcatggacacggtcggcttcctgatgatgagccac
atgaccacgccgcaggtgctggcgcagcaggccaggctgatggaaagctacggcgcaacc
tgcatctacgtcgttgactccggcggcgccctcaccatggacggcgtgcgcgaccgcttc
cgggcgttcaaggacgtgctcgatcccgtcacgcacaccggcatgcacgcccaccacaac
ctgagcctgggtgtggccaactccctggttgccgtggaagagggctgcaaccgcatcgat
gccagcctggccggcatgggtgccggggccggcaatgcgccgctggaagtctttatcgcc
gcggccgaacgcatgggctggaaccacggcaccgacctgtacaagctgatggacgccgcc
gacgacctggtgcgcccgctgcaggaccgcccggtgcgcgtggaccgcgagacgctggcg
ctcggttacgccggggtgtactcgagcttcctgcgtcattcggaagtggccgcggagcgc
tatggtctgaagaccgtcgacatcctggtcgagctcggccggcgccgtatggtcggcggc
caggaagacatgatcgtggacgtggccctcgacctgaagtcgcaacagaacgcagccgga
taa

DBGET integrated database retrieval system