KEGG   Ralstonia pickettii DTP0602: N234_37220Help
Entry
N234_37220        CDS       T03172                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00071  Fatty acid degradation
rpj00072  Synthesis and degradation of ketone bodies
rpj00280  Valine, leucine and isoleucine degradation
rpj00310  Lysine degradation
rpj00362  Benzoate degradation
rpj00380  Tryptophan metabolism
rpj00620  Pyruvate metabolism
rpj00630  Glyoxylate and dicarboxylate metabolism
rpj00640  Propanoate metabolism
rpj00650  Butanoate metabolism
rpj00900  Terpenoid backbone biosynthesis
rpj01100  Metabolic pathways
rpj01110  Biosynthesis of secondary metabolites
rpj01120  Microbial metabolism in diverse environments
rpj01130  Biosynthesis of antibiotics
rpj01200  Carbon metabolism
rpj01212  Fatty acid metabolism
rpj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N234_37220
   00630 Glyoxylate and dicarboxylate metabolism
    N234_37220
   00640 Propanoate metabolism
    N234_37220
   00650 Butanoate metabolism
    N234_37220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N234_37220
   00072 Synthesis and degradation of ketone bodies
    N234_37220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    N234_37220
   00310 Lysine degradation
    N234_37220
   00380 Tryptophan metabolism
    N234_37220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    N234_37220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    N234_37220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N234_37220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpj04147]
    N234_37220
Enzymes [BR:rpj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     N234_37220
Exosome [BR:rpj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   N234_37220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SnoaL_4 ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-GeneID: 17107355
NCBI-ProteinID: AGW95708
UniProt: U3QZP2
Position
3:594710..595918
Genome map
AA seq 402 aa AA seqDB search
MRRAAIVTPLRTPVGTFGGSLRPVPVEELAATAVRAVVQRSGIDPARIDDVVFAQSYANS
ETPCVGRWAALQAGLPVEVPGMQLDRRCGGGLQAIVTASMMVQSGAADVVIAGGVESMSN
IEYYTTDMRWGARSGNVRFYDRLDRGRERSQPVERFGKISGMIETAENLARDYGITREQA
DAFSVRSHERAAAAWEGGRFDAEIVTVQVPQRKGDPVTFARDEGFRPGTSLESLGKLRAL
MPNGTVTAGNASQQNDASAACLIVAEDKLAELGLTPMATLVGWAAAGCEPSHMGIGPVPA
VKKLLARLNLTLDQMDLVELNEAFACQVLAVLKGWDWNDQDAIEQKLNVNGSGISLGHPI
GATGVRILATLLHELQRRGGRYGLETMCIGGGQGIAAVFERC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgagccgctatcgtcaccccccttcgcacccccgtcggcaccttcggcggcagc
ctgcgccccgtgcctgtcgaggaactggccgccaccgcagtacgcgccgtcgtgcagcgc
agcggcatcgaccccgcgcgcatcgatgacgtggtctttgcccagtcctacgccaacagc
gaaacaccctgcgtgggccgctgggccgcgctgcaggccggcctgcctgtggaagtgccg
ggcatgcagctggaccgccgctgcggcggcggcctgcaggccatcgtcacggcctcgatg
atggtgcaaagcggcgctgccgatgtggtcatcgcaggcggcgtcgagagcatgagcaac
atcgagtactacaccaccgacatgcgttggggcgcgcgctcgggcaatgtgcgtttctac
gaccgccttgaccgcggccgcgaacgttcccagccggtcgaacgctttggcaagatctcc
gggatgatcgagacggccgagaacctggcccgcgactacggcattacccgcgagcaggcc
gatgccttctccgtgcgcagtcacgaacgcgctgcggcagcgtgggaaggcggccgcttc
gacgccgagatcgtgacggtgcaggtgccgcagcgcaagggcgaccccgtgacgttcgca
cgcgacgaaggcttccgccccggcacgtcgttggaaagcctcggcaagctgcgcgccctg
atgcccaacggcaccgtcaccgccggcaacgcaagtcagcagaacgacgcctcggcggcc
tgcctgatcgtggccgaggacaagctggccgagctgggcctgacccccatggccacgctg
gtgggctgggccgccgccggctgcgagccgtcgcacatgggcatcggcccggtacccgcg
gtgaagaagctgctggcgcgcctgaacctgacgctcgaccagatggacctggtggaactg
aacgaagccttcgcctgtcaggtactggccgtgctcaagggctgggattggaacgaccag
gatgccatcgaacaaaagctcaacgtgaacggctcgggcatctcgctgggccacccgatc
ggcgccactggcgtgcgcatcctggctacgctactgcacgaactgcagcgccgtggcggt
cgttatggcctggaaaccatgtgtattggcggcggccaaggcattgccgcagtatttgag
cgctgctga

DBGET integrated database retrieval system