KEGG   Rickettsia peacockii: RPR_02835
Entry
RPR_02835         CDS       T00907                                 

Definition
(GenBank) virB6b protein
  KO
K03201  type IV secretion system protein VirB6
Organism
rpk  Rickettsia peacockii
Pathway
rpk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPR_02835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpk02044]
    RPR_02835
Secretion system [BR:rpk02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RPR_02835
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: ACR47375
UniProt: C4K1C4
Position
480471..482456
AA seq 661 aa
MKTLKTLKIFIIVCIASVSLASFAGFGESCSSLPTTSDGYLETDTAYGYIIRNIDMKDPR
GNCNSVASSITFCFKNVEGSSSPCTMYTLNEGDSKKISDLSTDNNPDLGANPVLKNIVLT
VKKWDNDLCLVMPTSRGPMPVACKSLSATPTPPPPEDENCNIGKSCYTGANYSQSLINFS
GLAVQCLSATLNKIFFAGKSCSAQDQNSRITNLTAFSTFQGYLKRIIGAALILYTMFFAF
NMALNTEYASTEKIALFVIKFLFVAYFSIGLGPLDFSGGHPTKENGMLKYGLPLLTGAAP
DFAQMIFNAAGSRGLCQFDNSKYKDGYKFYGLWDAIDCRIGYYLGLDLLYNIDKNGVLGN
VVGNGPRGNNTPIPNFDPEGKNDRPKDLSKAGALRFFTVMFGFFMAGNVIILAAGLVFSV
IFLSILLYFITHYLVCMITIYVMTYISPIFIPMALFTRTKAYFDGWLKVCISCALQPAVV
AGFIALLITMYDSAIFKNCEFLRYDYEKGDIRFSTFELRLPVGGADQCQESFGYKMLEYY
AGKGWEEHLLILFPIKSIVRDVVSILAELLCVLVFSVIFYYFSKSIGRFASDLTNGPNMD
AVTASPTKIVGLVKKGAAFLKDAAMASQGKPLVGDKPGVGGKRKEGQQQGGDLASGSGGG
K
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgaaaactcttaaaaccttaaagatatttattatagtttgtatagcgtctgtaagctta
gctagctttgccggctttggagaatcatgttctagtttaccgactacttcagatgggtat
ttagaaacggacacggcatatggctatataattcgtaatattgatatgaaagatccgaga
ggtaattgtaactcagttgcgtctagtataacgttttgttttaaaaatgtagaaggtagt
agtagcccttgcaccatgtatactttaaatgaaggtgactctaaaaagattagtgattta
agtaccgataataatcctgatcttggagcaaatcctgtattaaagaatatcgttttaacg
gttaaaaaatgggataatgatctatgtttagttatgcctacgtcaaggggaccgatgccg
gtagcatgtaaatctttgagtgctacaccgactccacctcctcctgaggatgagaattgt
aatataggaaaaagttgctatacgggagcaaattatagtcaatcgttaattaatttttcc
ggtcttgcagttcagtgtttgagtgcaacgcttaataaaatattttttgctggaaagagt
tgtagtgctcaagatcaaaattctagaataactaatcttactgctttttctacgtttcaa
ggttatttaaagagaattataggtgcggcattaattctttatactatgttttttgccttt
aatatggctctaaatacagaatatgcaagtactgaaaaaatagctctttttgtaataaaa
ttcttatttgttgcttatttttctatcggtcttggacctttagattttagtggcggtcat
ccgacaaaagaaaacggtatgttaaaatatggattacctcttttgacaggagcagcaccg
gactttgcacagatgatctttaatgcagcaggttctagaggattatgtcaatttgataat
tcaaagtataaggacggttataaattttacggtttatgggacgcgattgattgccgtata
ggttattatcttggcttggatttactttataatatagataagaatggagtgttagggaat
gtggtcggcaatggtccccgtggtaataatacacctatacctaattttgatcctgaaggc
aaaaatgacagaccgaaggatttaagtaaagcaggagcacttagattttttaccgttatg
tttggattctttatggccggaaatgttattatacttgcagcaggtttagtattttctgta
atatttttatctatacttttatattttattacgcattatttagtttgcatgattactatt
tacgttatgacatatatttctcctatattcattcctatggctctatttactcgtacaaaa
gcttattttgacgggtggctaaaagtatgtatttcatgtgcattgcagccggcagtagta
gcaggttttatagctttattaataactatgtatgattccgcaatatttaaaaattgtgaa
ttccttagatatgattatgaaaaaggggatattagatttagtacttttgagttaaggctt
cctgttggcggggcagatcaatgtcaggaaagttttggatataaaatgttagaatattat
gcaggtaaaggttgggaagagcatttattgatactttttccaataaaatcaattgttaga
gatgttgtatctattttagcagaacttttatgcgtattagtattttcggttattttttat
tacttctctaaatctatagggcgatttgcttctgatttaactaatggtcctaatatggat
gcagtaacggcaagtcccactaaaatcgttggtttagtaaagaaaggagcagctttcctt
aaggatgctgctatggcttcgcaaggtaagccgctggtaggagataagccgggtgttgga
ggtaagcgtaaagagggacagcagcaaggcggggatttagcaagcggttcgggtggaggt
aaatga

DBGET integrated database retrieval system