KEGG   Rickettsia peacockii: RPR_04015Help
Entry
RPR_04015         CDS       T00907                                 

Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpk  Rickettsia peacockii
Pathway
rpk00020  Citrate cycle (TCA cycle)
rpk00190  Oxidative phosphorylation
rpk00650  Butanoate metabolism
rpk01100  Metabolic pathways
rpk01110  Biosynthesis of secondary metabolites
rpk01120  Microbial metabolism in diverse environments
rpk01130  Biosynthesis of antibiotics
rpk01200  Carbon metabolism
Module
rpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPR_04015
   00650 Butanoate metabolism
    RPR_04015
  Energy metabolism
   00190 Oxidative phosphorylation
    RPR_04015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 PAP2 Fumarate_red_D DUF1240
Motif
Other DBs
NCBI-ProteinID: ACR47501
UniProt: C4K1Q1
Position
complement(677820..678197)
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
LFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggaa
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaagattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgttactattgtagcttttgtagtagcg
ctgttttataaaggataa

DBGET integrated database retrieval system