KEGG   Rickettsia peacockii: RPR_04265
Entry
RPR_04265         CDS       T00907                                 

Definition
(GenBank) virB10 protein
  KO
K03195  type IV secretion system protein VirB10
Organism
rpk  Rickettsia peacockii
Pathway
rpk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rpk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RPR_04265
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rpk02044]
    RPR_04265
Secretion system [BR:rpk02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   RPR_04265
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ACR47542
UniProt: C4K1U2
Position
724295..725743
AA seq 482 aa
MAEEQNNNHNTGALSGADSPEVQRELSKVSVSFNKSIAIVVVICGIFIYIFYTLFFGTEK
EEIPETQIPSNIVKPVTEVDDNIPEIPKLPDPPKLETPTAPPPPPPPVVKVPPVLPPTTP
VEENKDKTLPLPPVSLPSTSGTLVESDAEKQRREAKRKSAIVLIGGVEPKKTPEQITAET
TFKDRGDMSLVLGRGKLIDAVLETAINSDLGGEIRAIISRDVFSEKDKVILIPKGSKIFG
KYATSTSSDSYGRVSIIWDRIDLTSGYTIEFDSPAVDNLGRPGLQGRVDNKYKEQFANAV
LQSGFNIGLAKVLDKLVPPPIASQAAATNSATAKQLLNTAQTIASNAAMDANTRIVTICT
NILAAITDKTSTAYTTMTQACTTAQTASSANTAEQRLQTLVQAVNTAASSLLTTTSIAST
PTQAQQASTQAFTDVTNVIKNMITQQQFKPTTTVNQGTPVRIYVNKDYKFPKAVLLKSKV
MK
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggctgaagagcaaaataacaatcataataccggtgctttatcaggagcagattctcct
gaagtacaaagagaattatcaaaagtttcggttagctttaataagagtattgcgatagta
gtcgtaatttgtggtatttttatatatattttttatactctttttttcggtactgaaaaa
gaagaaataccggagactcagataccgagtaatattgtaaaacctgttacggaggttgat
gataatattccggagattccaaagttacctgatccgcctaagcttgagacgcctaccgct
cctccaccgcctccccctccggtagtaaaagttccaccggtcttacctcctactactcct
gtagaagagaataaagacaaaacgcttccattgccaccggtttcgttgccttcgacttca
ggaacgttagttgagagcgatgcagagaagcaacgtcgtgaagcaaaaagaaaatcagct
atagtgttaattggtggtgtagagcctaaaaaaacaccggaacagattacggcagaaacg
acctttaaagatcgcggtgatatgtctttggttctcggacgcggtaaattaattgatgca
gtccttgagacggcaataaatagtgatctcggcggtgaaataagagccattattagtaga
gacgtattttctgagaaagataaagtgatattgataccgaaagggtcaaaaatattcggt
aaatatgcaacctcaacttcgtccgatagttatggtagagtttctataatatgggataga
atcgatttaacgagcggttatactatagaattcgactcacctgcagttgataatttaggt
agaccgggattacaaggaagagttgataataaatataaagaacaatttgcaaatgccgta
ttacaatccggctttaatatagggcttgctaaagtccttgataagttagtgccgcctcct
atagcttctcaggcagcggctaccaatagtgctacggcaaaacaattgttaaatactgct
caaactattgcgtctaatgccgctatggatgcaaatactaggatagttacaatttgtact
aatatacttgctgctattaccgataaaacttcgactgcttatactactatgactcaagca
tgtacaaccgcacaaactgcttcttcagcgaatactgctgagcagagacttcaaacctta
gtacaggcagttaatacggcagcttcaagtttgcttactactacctctatagcatcaact
ccgacgcaagcacaacaagcttctactcaagcttttacggatgtaacgaatgttataaaa
aatatgataactcagcagcagtttaagccgacgacaacggttaatcaaggtacgccggtt
agaatatacgttaataaggattataaattcccaaaagccgttttattaaaatcgaaggta
atgaaatga

DBGET integrated database retrieval system