KEGG   Rickettsia prowazekii Breinl: H375_730Help
Entry
H375_730          CDS       T02543                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
rpl  Rickettsia prowazekii Breinl
Pathway
rpl00130  Ubiquinone and other terpenoid-quinone biosynthesis
rpl01100  Metabolic pathways
rpl01110  Biosynthesis of secondary metabolites
rpl01120  Microbial metabolism in diverse environments
rpl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    H375_730
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H375_730
Enzymes [BR:rpl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     H375_730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-GeneID: 15150814
NCBI-ProteinID: AGJ02299
Position
complement(97560..98129)
Genome map
AA seq 189 aa AA seqDB search
MIKNKKIIIAISGASGAIYGIRLLKVLKEQNIETHLVISDGAALTIKFETKYSIQEVKFL
ANYCYDEKNLGAAISSGSFKTAGMIIAPCSMKTLASIAHSMEDSLISRAAGVVLKERRKL
ILMTRETPLHIGHLENMLKVAHYGGIIAPPIPAFYNKPTRINDIIDHSITRVLDFFDIET
NLIKRWSSD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaataaaaagattattatagcaatttctggtgcatcaggagcaatatacggt
attcgtttacttaaagtactcaaagaacaaaatatcgaaactcatttagttatttcagat
ggcgcagctcttactataaaatttgaaactaaatattctatacaggaagtcaaatttctt
gctaattattgttatgacgaaaaaaatttaggagctgctatttccagtggttcttttaaa
actgctggaatgataatagccccttgtagcatgaagactttagcaagtatcgcacactca
atggaagatagtttaattagtagagcagcaggagttgtacttaaggaaagacgaaagctt
attttaatgacccgtgagactccactacatataggacatttagaaaatatgttaaaagta
gctcattatggaggaatcatagcaccacctataccagctttttataataagcccacaagg
ataaatgatataatagatcactctattactagagtgctagatttttttgatattgaaact
aacttgattaaacgatggagtagtgattag

DBGET integrated database retrieval system