KEGG   Candidatus Rhodoluna planktonica: A4Z71_00760Help
Entry
A4Z71_00760       CDS       T04564                                 

Definition
(GenBank) aspartate--tRNA(Asn) ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
rpla  Candidatus Rhodoluna planktonica
Pathway
rpla00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rpla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4Z71_00760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpla01007]
    A4Z71_00760
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpla03016]
    A4Z71_00760
   03029 Mitochondrial biogenesis [BR:rpla03029]
    A4Z71_00760
Enzymes [BR:rpla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     A4Z71_00760
Amino acid related enzymes [BR:rpla01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   A4Z71_00760
Transfer RNA biogenesis [BR:rpla03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A4Z71_00760
 Prokaryotic type
   Other AARSs
    A4Z71_00760
Mitochondrial biogenesis [BR:rpla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A4Z71_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: AOY56677
UniProt: A0A1D9E0T5
Position
complement(149571..150896)
Genome map
AA seq 441 aa AA seqDB search
MRERTLVKDLAARADGPVVLGGWVEKLRDQKRIQFVILRDESGDVQVTYPRPVIDEQPDE
NDALAAKISTLTSGSFVWVTGRLVHDERVKLGGLEIQLEDLEIVTLADPISPIAEDTSID
KRLDWRFLDLRRTEMNLVFQIQTTIEAAWREYWVENGFVEIHSPKLMASPSESNAELFKL
EYFEGNAYLAQSPQFYKQMAMMSGLGRIFEIGPVFRADPSFTSRHATEFVSVDIEVSWID
SHEDIMAIQEQLLHRAISAVKEKHGDEILKHFGVEVQVPSIPFPRISLNDAVEIIKQRGH
SVERAGDLDPEGERQIAAHVAEEFGHEFVFVTDYPATVRPFYHMRHEDNPALTKSYDLIW
RGTEITTGAQREHRLDVLIEQVKQKGLEPEGLQTYLDFFKYGAPAHGGFGMGLLRVLMLL
LHQPNIREVGFLFRGPNRLEP
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagcgcacacttgtcaaagaccttgcggcacgtgccgatggtccagttgttttg
ggtggctgggttgagaaacttcgcgatcagaagcgcatccagtttgtgattttgcgcgac
gaatcaggcgatgttcaggtcacctacccgcgaccagttatcgacgaacagccggatgag
aatgacgcgctcgctgccaagatttctaccttgaccagcggatcgtttgtctgggttacc
ggacgcctggttcacgatgagcgcgtcaaactgggcggtcttgaaatccaacttgaagac
ctcgagattgttactctcgctgacccaatcagcccaatcgctgaagacacctcaatcgat
aagcgactcgactggcgcttcttagatctccgtcgcaccgagatgaacttggttttccaa
attcaaaccaccattgaagctgcctggcgcgaatactgggttgaaaacgggtttgtcgaa
attcactcgccgaagctgatggcttcaccttctgaatcaaacgccgaacttttcaagctc
gagtactttgagggcaatgcctacttggcacaatctcctcagttctataagcaaatggca
atgatgtcgggcttgggccgaatttttgaaatcggcccagtgtttagagctgacccatca
tttacctcgcgtcacgccaccgaattcgtctcggtagacatcgaagtctcatggattgac
tcacatgaagacatcatggcgattcaggagcaactgcttcaccgagccatcagcgcggtc
aaagaaaagcacggcgacgagattcttaagcacttcggtgttgaggttcaggttccgagc
attccgttcccaagaatttcgctgaacgatgccgtcgaaatcatcaagcagcgcggccac
agcgttgagcgagccggtgacctagacccagagggcgagcgtcagattgcggctcacgtg
gccgaagaatttggtcacgagtttgttttcgtgaccgactatccggcaactgttcgcccg
ttctatcacatgcgtcacgaagacaatccggcactgaccaagagctacgacctaatttgg
cgcgggaccgaaatcaccaccggtgcgcagcgtgaacaccgtctagatgttttgatcgag
caggtaaagcaaaaaggtctagagccagagggtctgcagacctaccttgacttcttcaag
tacggagccccggcccacggtggtttcggcatgggtctactgcgtgttttgatgttgctg
ttgcaccagccaaacattcgcgaagtcggcttcctgttccgcgggccaaaccgtctagag
ccttaa

DBGET integrated database retrieval system