KEGG   Candidatus Rhodoluna planktonica: A4Z71_04245Help
Entry
A4Z71_04245       CDS       T04564                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
rpla  Candidatus Rhodoluna planktonica
Pathway
rpla00020  Citrate cycle (TCA cycle)
rpla00620  Pyruvate metabolism
rpla01100  Metabolic pathways
rpla01120  Microbial metabolism in diverse environments
rpla01200  Carbon metabolism
rpla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4Z71_04245
   00620 Pyruvate metabolism
    A4Z71_04245
Enzymes [BR:rpla01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     A4Z71_04245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 GCV_H ATPgrasp_ST acVLRF1
Motif
Other DBs
NCBI-ProteinID: AOY56185
UniProt: A0A1D9DZF2
Position
complement(850610..854017)
Genome map
AA seq 1135 aa AA seqDB search
MFKKILVANRGEIAVRAMRAAYELGAKTVAVFPFEDRNSTHRLKADEAYQIGEIGHPVRA
YLDVDEIIRVAKESGADAIYPGYGFLSENPELARAAKENGIAFIGPSESVLEMAGNKVTA
KESAIRAGVPVLKSTQSSANVDELVDQADSIGFPIFVKAVAGGGGRGMRRVTKKEDLRAA
LVEASKEAESAFGDPRVFLEQAVLRPRHIEVQILADTQGNVVHLFERDCSIQRRNQKVVE
IAPAPLIDEELRQTLYRDAVSFASQIGYQNAGTVEFLVDTIGDNAGKHVFIEMNPRIQVE
HTVSEEITDIDLVQSQMRIAAGESLVDLGLTQDKITMHGFAVQCRITTEDPAQNFRPDTG
KITTYRSPGGAGIRLDGGTVSTGAEVSPHFDSMLVKLIARGRDFKSAVTRSKRALAEFRI
RGVSTNIAFLQAVMNDPIFASGDLSTSFIDEHPELFTAKPSQDRGTKILNWLADVTVNQP
NGPRGQHISPSEKLPAVDLVLPAPAGSRQLLQQLGPAGFAKALREQTSVAVTDTTFRDAH
QSLLATRVRGRDLVEAAPYVARLTPQLLSVEAWGGATYDVALRFLGEDPWQRLEALRAAM
PNLCIQMLLRGRNTVGYTPYPTEVTEAFVKEAAETGIDIFRIFDALNDIEQMKPAIDAVL
ATKTAVAEVALCYTADLLDPNETLYTLDYYLGLAQQIVDAGAHIIAIKDMAGLLRPAAAE
KLVTALRERFDLPVHLHTHDTAGGQLATLMAAINAGVDAVDVASAPMAGTTSQPSASALV
AALAHTERDTGISLTSVTSLEPYWEAVRSVYAPFESGLPGPTGRVYEHEIPGGQLSNLRQ
QAIALGLGDHFEKVEEMYAAASRILGRPTKVTPSSKVVGDLALHLVAVNADPADFAENPQ
NYDVPDSVVGFLAGELGDLPGGWPEPFRTKVLQGKNPKFGITEVPHAELAILTGDDKDRR
RMLLNRLLFPGPTNEFIKTRETYGNLDAVDTVDYLYGLEQGVEHVVEIAKGVRLFVGLEA
IGTPDAKGYRTVMATLNGQLRPINVRDRKVAVETVSVEKADSSNLGHVAAPFSGVVTLQI
AEGTHVDVGSPVATIEAMKMEATITSSVKGVVKRLAVGKTQAVDAGDLILVVEPE
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaaaaaatccttgtagctaaccgaggtgaaattgcggttcgtgcaatgcgagca
gcatacgaacttggggccaagaccgtggccgttttcccttttgaggatcgaaactctact
caccgtctaaaagctgacgaggcatatcaaatcggtgagattggccatccggttcgggcg
taccttgatgtcgacgaaatcatccgcgttgccaaagaatctggcgccgatgcaatttat
ccgggctacggctttctgtcggaaaaccccgaattggctagagccgcgaaagaaaacggt
attgcatttatcggcccttcggaatcagttctggaaatggccggaaacaaagtcactgcc
aaggaatctgcaattcgggcaggcgttccagtcttgaaatcaacgcaatcttcggcaaac
gtcgatgagttggtagatcaggctgattcaatcggttttcctatttttgtcaaagctgtt
gccggtggtggcgggcgaggcatgcgccgcgtaacgaaaaaagaagacttacgagccgct
ctagttgaggcctcgaaagaggctgaaagcgcatttggtgatcctcgcgtattccttgaa
caagcagtattgcgaccgagacacattgaagtgcagattttggccgacactcagggcaat
gtcgtgcacctttttgaacgcgattgttcaattcagcgacgcaaccaaaaagttgtcgag
atcgcaccggccccgctaattgatgaagaacttcgacagaccctttaccgggatgcggtt
tcgtttgccagccagatcggttatcagaatgctggaaccgtcgagttcttggtggacacc
atcggtgacaatgctggaaaacacgtatttatcgaaatgaatcctcgaattcaggtcgag
cacacagtttctgaagaaattaccgatattgacctggttcaatcacaaatgcgcattgca
gctggagaatcgctggttgatttggggctaactcaagacaagattacgatgcacggtttt
gcggtgcagtgtcgaatcaccaccgaagacccagcgcagaacttcaggcccgacaccgga
aaaattaccacctaccgttcacctggcggtgctggtattcgactcgatggcggtacagtg
tcgaccggtgccgaagttagcccgcactttgactcaatgctcgtgaaactaattgcgcgc
ggacgtgatttcaagtcagcggttacccgttctaagcgtgcactggcagaatttagaatc
cgtggtgtttccaccaacattgcatttttgcaagcggtaatgaatgatccgattttcgcc
agcggtgatttgagcacgtcattcatcgacgagcatcctgaacttttcactgccaagccc
tcgcaagaccgcggcaccaagattttgaattggcttgccgatgtgacagtaaatcagcca
aatgggcctcgtggccagcacatttcacctagcgaaaaacttccggctgttgacttggtt
ttgccagcaccagccggcagtcgccagcttctgcaacaacttggcccagcagggtttgcc
aaggcacttcgagagcaaacttcggtcgctgttactgacactactttccgtgatgcgcac
cagtcattgcttgccaccagagttcgcggccgcgatttggttgaagcagcaccgtatgtt
gctcgacttactccacaacttctttctgttgaagcgtggggcggtgccacgtacgacgtt
gcacttcgtttcttgggggaagacccgtggcagcgacttgaagctctgcgtgctgcaatg
cctaacctctgcattcaaatgcttcttcgaggccgaaatacggttggttacacaccttac
ccaaccgaggtaaccgaggcttttgtaaaagaggcagcagaaactggaatcgacattttc
cgcatctttgatgcgctcaacgatatcgagcagatgaaaccagcaattgatgctgttctg
gcaaccaagactgcagtggctgaagtcgcactgtgttacaccgcagatttgctcgaccct
aacgagacgctgtacaccctcgattactacctgggcctagcgcagcaaattgttgacgcc
ggtgcccacatcatcgccatcaaagacatggctgggttgctccggccagcagccgcagaa
aagttggtgacagcgctccgtgagcgatttgatcttccagttcacttgcacacccacgac
acagccggaggccagttagcaactcttatggcagccataaatgccggagtggacgctgtg
gatgttgccagtgcaccgatggcggggactacgtctcagccttcggcctctgctttggtc
gccgctttggcccacaccgaacgtgacaccggaatctcgctaacttcggtcacatcccta
gagccttactgggaagccgtccgttcggtttacgcgccattcgagtccggcttgcctggt
ccaactggccgagtttacgagcatgaaatcccgggtggtcaactatctaatctgcgtcag
caggcgattgctcttggtcttggcgaccactttgaaaaagtggaggaaatgtacgctgcc
gcaagtcgaatccttggtcgacctaccaaagtcacgccgtcatctaaggttgtcggtgat
cttgctctgcacctggttgcagtcaatgctgacccagccgattttgcggaaaatccgcaa
aattacgatgttcctgattcagtcgtgggcttcctggcaggtgagttgggcgatctacca
ggtggttggccagagcctttccgcaccaaagtgctgcagggtaagaatccaaaatttgga
atcaccgaagttccgcacgccgagcttgcgattttgaccggtgatgacaaagaccgtagg
cgaatgttgctgaaccgactgcttttccctggtccaaccaacgagtttattaagacccgc
gaaacctatggcaacctcgatgccgtggataccgtcgactacctctacggcttagagcag
ggtgtcgagcacgtggtcgagatcgccaagggtgtccgcttgtttgttggccttgaagca
atcggaactccagacgccaaaggctatcgaaccgtgatggcaactctaaacggccaactt
cgacccatcaacgttcgtgatagaaaagtcgcggtagagacggtttctgtagagaaggca
gactcgagtaatctcggtcatgtggcagccccattttctggggtggttacgcttcagatt
gccgagggcacgcacgtcgatgtgggttcaccggttgcgaccattgaagctatgaagatg
gaagccaccataaccagcagcgtcaaaggtgtcgtaaagaggcttgccgttggtaagact
caagcagtcgacgcgggtgacctaatcctggttgtcgaacccgagtaa

DBGET integrated database retrieval system