KEGG   Raoultella planticola: B1209_04800Help
Entry
B1209_04800       CDS       T05298                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rpln  Raoultella planticola
Pathway
rpln00860  Porphyrin and chlorophyll metabolism
rpln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B1209_04800
Enzymes [BR:rpln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     B1209_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA GATase Peptidase_C26 SNO
Motif
Other DBs
NCBI-ProteinID: AUV52250
UniProt: A0A443VNS9
Position
975869..977392
Genome map
AA seq 507 aa AA seqDB search
MTQAIMLQGTASDVGKSVLVAGLCRIFYQDGRRTAPFKSQNMALNSGITADGKEMGRAQI
FQAEAAGIEPDVRMNPVLLKPTSDLKAQVVLMGKVATNMDAVSYHEYKPRLREQILSVYR
SLAQEYDVLVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFAAIYGTLA
LLEEQERARVKGVIINKFRGDIALLYSGIEQIEALTGVPVLGVLPWLEVDLEDEDSVALQ
KGKYLSTAKREIDIAVVQLPHTSNFTDFNALAAQPDVRVRYVRHPQELAQADLVILPGSK
NTLGDLLWLRDSGMAAGVLQARQQGIPLLGICGGYQMLGETIVDEVESGLGTQPGLGLLN
TVTQFARHKTTTQVDATMASALPDWLAGASALRVRGYEIHMGETTLNGSCRPLMQLEKDG
ELVADGAMTDDGLVFGTYLHGLFDSDDFTRALVNGLRRRKGLDALDTALHYAQYKSQQFD
ILAAAMRQHIDIEKIYHIMQQHQEPSC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcaattatgttgcaggggacggcgtccgatgtcggtaaaagcgtgctggtg
gccggtttatgccgcattttctatcaggatggccggcgtacggcgccgtttaaatcgcag
aatatggcgctcaattcggggatcacggcggacggcaaagagatgggccgggcgcagatc
tttcaggccgaggccgccggtatcgaacccgacgtgcggatgaaccctgtcttgctgaaa
cccaccagcgacctgaaagctcaggtggtgctgatgggcaaagtggcgacgaatatggat
gcggtgagttaccacgagtataaaccgcgcctgcgcgaacagatcctctcggtctatcgc
agcctggcgcaggagtatgatgtgctggtcctggaaggggccggtagcccggcggagatc
aacctgcgcgatcgcgatatcgtcaatatggggatggcggagatggcgcagtgcccggtg
atcctggttgccgatatcgacagagggggcgtctttgccgcgatctacgggacgctggcg
ctgcttgaggagcaggagcgcgcccgggtgaaaggggtgattatcaataaattccgcggc
gacattgcgctgctctattccggaatcgaacagatcgaagcattaaccggcgtccccgta
ctgggagtactgccgtggctggaggtcgatctggaggatgaggatagcgtggcgctgcag
aaagggaagtatctgagcaccgcgaagcgcgagatcgacatcgcggtcgttcagcttccc
catacctcaaacttcaccgatttcaacgcgctggcggcgcagccggatgtccgcgtgcgc
tacgtacggcacccgcaggagctggcgcaggccgatctggttatcctgcccggcagtaaa
aatacgctgggcgatctgctgtggctgcgcgactctgggatggcggcgggcgtcttgcag
gcacgtcagcaggggattccgctgttggggatctgcggcggctatcaaatgctgggtgag
acgattgtcgatgaggtggaatccggcctggggacgcagcccggcctcggtctgctcaat
accgtgacgcagtttgcccgacataaaaccaccactcaggtcgacgcgacaatggcgagc
gcgctgccggactggctggcgggcgcgtctgccctgcgggtgcgaggttacgaaattcat
atgggggaaacgacccttaacgggagctgccgtccgttgatgcagctggagaaagatggc
gagctggtggcggatggcgcaatgacggatgatggactcgtattcgggacttatctgcac
ggcctgttcgacagcgatgatttcacccgcgcgctggtcaacggcctgcgtcggcgcaaa
gggctggatgcgctggataccgcccttcactatgcgcaatacaaatcgcaacagttcgat
atcctggccgccgccatgcgccagcatattgatatcgaaaagatttatcacatcatgcag
cagcatcaggagccatcatgctga

DBGET integrated database retrieval system