KEGG   Raoultella planticola: B1209_07145Help
Entry
B1209_07145       CDS       T05298                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
rpln  Raoultella planticola
Pathway
rpln00130  Ubiquinone and other terpenoid-quinone biosynthesis
rpln00627  Aminobenzoate degradation
rpln01100  Metabolic pathways
rpln01110  Biosynthesis of secondary metabolites
rpln01120  Microbial metabolism in diverse environments
rpln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    B1209_07145
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B1209_07145
Enzymes [BR:rpln01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     B1209_07145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Semialdhyde_dh DUF3018 CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AUV55866
Position
1465425..1466009
Genome map
AA seq 194 aa AA seqDB search
MKRLIIGISGASGAIYGVRLLQILRDVPDVETHLIMSQAARQTLALETEYSLREVQALAD
VVHDARDIAASISSGSFKTAGMVILPCSVKTLSGIVHSYTDGLLTRAADVVLKERRPLVL
CVRETPFHLGHLRLLVQAAEMGAVIMPPVPAFYHRPQTLDDVINQTVNRVIDQFDITLPQ
DLFTRWQGPSGALK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacttattattggtatctctggcgccagcggcgccatttacggtgtgcgactg
cttcagattttacgcgatgtgcctgatgtcgaaacgcatctgatcatgagccaggcagcg
cggcagacgctggcgctggagaccgagtactctctgcgggaagtgcaggcgctggcggat
gtggtccatgatgcgcgcgatatcgccgccagtatctcgtcggggtcgttcaagacggcc
ggaatggtgattctgccttgctcggtgaaaacgctttctggcattgttcacagctatacc
gatggtctgctgacccgcgcggcggacgtggtcctcaaagagcgtcgtccgctggtactg
tgcgtgcgggaaacgccgttccatctcgggcatctgcgcctgctggtgcaggcggcagag
atgggagcggtgattatgccgccggttccggccttctaccatcgcccacaaaccctcgat
gatgtgattaatcagaccgtcaaccgggttatcgatcagttcgatattaccctcccgcag
gatctgtttacccgttggcagggaccttcgggcgcactaaagtag

DBGET integrated database retrieval system