KEGG   Raoultella planticola: B1209_07175Help
Entry
B1209_07175       CDS       T05298                                 

Definition
(GenBank) histidine/lysine/arginine/ornithine ABC transporter ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
rpln  Raoultella planticola
Pathway
rpln02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B1209_07175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rpln02000]
    B1209_07175
Enzymes [BR:rpln01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     B1209_07175
Transporters [BR:rpln02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    B1209_07175
   Histidine transporter
    B1209_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_16 AAA_13 AAA_33 AAA_23 G-alpha PRK AAA_24 RsgA_GTPase NACHT DUF3516 ATPase_2 DUF87
Motif
Other DBs
NCBI-ProteinID: AUV52636
UniProt: A0A2X2ECD4
Position
1469589..1470362
Genome map
AA seq 257 aa AA seqDB search
MSDNKLNVIDLHKRYGEHEVLKGVSLRAQAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVNGQNIGLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQQARERAVKYLAKVGIDERQQIKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGHPDELF
GNPKSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaataaattaaatgttatcgatctccataaacgttacggcgagcatgaggtg
ctgaaaggcgtctcgttacgggcgcaagccggggacgttatcagcattatcggttcatcg
ggttccggtaaaagtacctttttgcgctgcattaacttcctggaaaagcccagcgaaggc
acgatagtggttaacgggcagaatattggtctggtccgcgacaaagacggtcagctgaag
gtcgcagataaaaaccagctgcgtctgctgcgtacgcgcctgacgatggtgttccagcat
ttcaacctgtggagccatatgacggtgctggaaaacgtcatggaagcgccgattcaggtt
ctcgggctgagtaagcagcaagcgcgcgagcgggcggtgaaatatctggcgaaagtgggc
attgatgagcgccagcagatcaaatacccggtgcatctctccggcggtcagcagcaacgc
gtctccattgcgcgtgcgctggcgatggagcccgatgtgctgctgtttgacgaaccgact
tccgcgcttgaccctgaactggtaggggaagtgctgcgtatcatgcagaagctggcggag
gaggggaaaaccatggtggtagtgacccatgaaatgggctttgcgcgccatgtctcgtcg
cacgtcattttcctgcaccagggcaagattgaagaagaaggccatccggatgagctgttc
ggcaatccgaaaagcccccgcctgcagcagttcctgaaaggctccttgaagtaa

DBGET integrated database retrieval system