KEGG   Raoultella planticola: B1209_20020Help
Entry
B1209_20020       CDS       T05298                                 

Definition
(GenBank) NAD(P)H-dependent oxidoreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
rpln  Raoultella planticola
Pathway
rpln00633  Nitrotoluene degradation
rpln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    B1209_20020
Enzymes [BR:rpln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     B1209_20020
  1.-  
   1.-.-  
    1.-.-.-  
     B1209_20020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase GramPos_pilinD1 TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AUV54698
UniProt: A0A2X2G415
Position
4152770..4153423
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRHSTKAFDATKKLTAEEAEKLKTLLQYSPSSTNSQPWHFIVASTDEGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLERVVDQEEADGRFATPEAKAANHKG
RLFFADMHRKDLHDDNHWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFTILDAEFDLKA
QGYTSLVVVPVGHHSVEDFNAGLPKSRLPQATTITEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtctccgttgccttaaagcgccactccacgaaagccttcgatgccacaaaa
aaactgactgctgaagaagccgaaaagctgaaaacgttgctgcaatacagcccgtcgagc
accaactctcagccgtggcactttatcgttgccagcacggatgaagggaaagcccgcgtg
gcgaaagccgccagcggcacctatgttttcaacgaacgtaaaattcttgatgcttctcat
gtcgtggttttctgtgccaaaacggccatggacgacgcctggctggagcgcgtggtggac
caggaagaggccgacggacgcttcgccaccccggaagccaaagccgctaaccacaaaggc
cgccttttctttgccgatatgcaccgcaaagatctgcatgacgataaccactggatggcg
aagcaggtttacctcaacgtcggcaacttcctgctcggtgtcgcggcgatggggctggat
gcggtgccgatcgaaggcgtcgatttcacgatcctcgatgcggagttcgacctgaaagcg
cagggctataccagcctggtggttgttccggtcggccaccacagcgtagaagatttcaac
gccgggctgccgaaatcgcgcctgccgcaggcaacgaccatcaccgagatttaa

DBGET integrated database retrieval system