KEGG   Raoultella planticola: B1209_20190Help
Entry
B1209_20190       CDS       T05298                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
rpln  Raoultella planticola
Pathway
rpln00052  Galactose metabolism
rpln00500  Starch and sucrose metabolism
rpln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    B1209_20190
   00500 Starch and sucrose metabolism
    B1209_20190
Enzymes [BR:rpln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     B1209_20190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AUV54721
Position
4192560..4193960
Genome map
AA seq 466 aa AA seqDB search
MSLPSRLPAILQAVMQGQPRALADSHYPRWHHAPVTGLMNDPNGFIEFAGRYHLFYQWNP
LACDHTFKCWAHWSSADLLHWQHEPIALMPDEEYDRNGCYSGSAVDNNGTLTLCYTGNVK
FADGSRTAWQCLATENADGTFSKTGPVLPLPEGYTGHVRDPKVWRHEDRWYMVLGAQDRQ
KCGKVLLFSSADLSQWTNEGEIAGAGINGLHDAGYMWECPDLFPLGDQHILICCPQGITR
EKERYLNTYPAVWMAGGFDYASAAFTHGELHELDAGFEFYAPQTMQTTDGRRLLVGWMGV
PDGEEMRQPTRANGWIHQMTCLRELEWVDGKLYQRPLRELSALRGEVRGWQGNVLPLAPL
EIALDTAGDDAFSLDFGGALTLERDTRGLRLARRSLASDDMLYRYWRGEVRSLRIFVDRS
SVEIFINDGEGVMSSRLFPDYPAQLIFSGATPVTFCYWSLEPCMVE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttccatcacgcctgcctgcgattttgcaggccgtaatgcagggccagccgcgt
gcgctggccgatagccactatccccgctggcaccatgcgccggtcaccgggctgatgaac
gaccccaacggctttatcgaatttgccgggcgctaccacctgttctatcagtggaatccg
ctcgcctgcgatcataccttcaagtgctgggcgcactggagctcggccgatctgctgcac
tggcagcatgaaccgattgcgctgatgccggacgaagagtatgaccgcaacggctgctac
tccggcagcgcggtggataacaacgggacgctgactctgtgctacaccggcaacgtcaag
tttgcagacggcagccggaccgcctggcagtgcctggcgacggaaaatgccgacggcacc
ttcagcaaaaccggcccggtcctgccgctgccggagggctataccggccacgtgcgcgac
ccgaaagtgtggcggcatgaagaccgctggtacatggttttaggcgcacaggatcggcaa
aaatgcggcaaggtgctgctgttcagctctgcggacctctctcaatggaccaacgaaggc
gaaatcgccggcgccggtatcaacggactgcacgatgccggttacatgtgggagtgtccg
gacctgttcccgcttggcgaccagcatattctgatttgctgcccgcaggggattacccgc
gagaaagagcgctacctcaacacttatccggcggtgtggatggccggcggcttcgactac
gccagcgccgccttcacgcacggcgagttgcacgagctggatgccgggtttgagttctac
gccccgcaaaccatgcagacaaccgacggccgccggctgctggttggctggatgggcgtc
ccggacggcgaggagatgcgccagccgacgcgggccaacggctggatccaccagatgacc
tgcctgcgcgaactggagtgggtggacggcaaactctatcagcgcccgctgcgcgaactg
agcgccctgcgcggcgaagtccgcggctggcagggcaacgttctgccgctggcgccgctg
gagatagccctcgataccgccggtgacgacgcgtttagcctcgatttcggcggcgcgttg
accctcgagcgcgatacccgcggccttcgtctggcgcggcgcagcctcgccagcgacgac
atgctctatcgctactggcgcggcgaggttcgctcgctgcggatcttcgtcgaccggtcg
agcgtggagattttcattaacgacggcgaaggggtaatgagcagccgcctcttcccggac
tatccggcacagctgattttcagcggcgcgacgccggtaacattctgctactggtcgctg
gagccatgcatggtagaataa

DBGET integrated database retrieval system