KEGG   Raoultella planticola: B1209_23235Help
Entry
B1209_23235       CDS       T05298                                 

Definition
(GenBank) trifunctional nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase/transcriptional regulator NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
rpln  Raoultella planticola
Pathway
rpln00760  Nicotinate and nicotinamide metabolism
rpln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    B1209_23235
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rpln03000]
    B1209_23235
Enzymes [BR:rpln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     B1209_23235
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     B1209_23235
Transcription factors [BR:rpln03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    B1209_23235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 CTP_transf_like Citrate_ly_lig ABC_tran HTH_37 MMR_HSR1 HTH_35 AAA_29 FAD_syn Dynamin_N
Motif
Other DBs
NCBI-ProteinID: AUV55211
Position
complement(4816978..4818210)
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQKGCTLQQVAEASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RRQKSVGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRQLFEDSAMSQQPTV
SDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSRGIRAFMSDKGIQPNWIYTSEE
ADAQQYLQHLAIETVLIDPKRTFMSISGGQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVSTQAFCLKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQTLLVSLLKENEIDFVHVKESDYDTRFLRCVDLVKQLMGEPD
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatctttcgactatctcaaaaccgcgattaagcaaaagggctgtacgctgcaacag
gtcgcggaagccagcggaatgaccaaaggctatttgagccagctgctgaatgccaaaatc
aaaagcccaagcgcgcagaagctggaagccctgcaccgttttcttggcctggaattcccg
cgtcggcaaaagagcgtcggcgtggtatttggtaagttctatccgctgcacaccggacat
atctatctgattcagcgcgcctgtagccaggtggatgagctgcatatcatcatgggttac
gacgatacgcgcgatcgtcagctgtttgaagacagcgcgatgtcgcaacagccgacggta
tccgatcgtctgcgctggctgctgcaaaccttcaaatatcagaaaaatatccgtattcat
gcgtttaatgaagaggggatggaaccttatccccacggctgggacgtctggagccgcggg
atccgcgcatttatgagcgataaagggatccagccgaactggatctacacctcggaagag
gcggatgcgcagcaatatctgcagcatctggcgatcgaaaccgtgctgatcgatccgaaa
cgaacctttatgagcatcagcggcggacagatccgtgaaaacccgttccgctactgggag
tacatcccgacggaagtgaaaccgttcttcgtgcgtacggtggcgattcttggcggcgaa
tcgagcgggaaatcgactctggtcaataagctcgcgaatatctttaacaccaccagcgcc
tgggagtatggtcgcgattacgtcttctcgcacctcggcggcgatgagatggcgctacag
tattccgactatgacaaaattgcgcttggccacgcgcagtatattgattttgcggttaaa
tatgccaataaggtggcgtttatcgacaccgatttcgtcagcacccaggccttttgcctg
aagtatgaagggcgtgaacatcccttcgtgcaggcgctgatcgatgagtaccgttttgat
ctggtgattctgctggagaacaataccccgtgggtggccgatggtttacgtagcctcggc
agttcggtggatcgcaaggagttccagacgctgctggtgtcgctgctcaaagaaaatgag
atcgactttgtgcatgtgaaagagtcggattacgacacgcgctttctgcgctgcgttgat
ttggtcaagcagctgatgggtgagccggactaa

DBGET integrated database retrieval system