KEGG   Raoultella planticola: B1209_26330Help
Entry
B1209_26330       CDS       T05298                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
rpln  Raoultella planticola
Pathway
rpln00561  Glycerolipid metabolism
rpln00640  Propanoate metabolism
rpln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    B1209_26330 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    B1209_26330 (gldA)
Enzymes [BR:rpln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     B1209_26330 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase DUF190
Motif
Other DBs
NCBI-ProteinID: AUV55712
Position
5452816..5453913
Genome map
AA seq 365 aa AA seqDB search
MDRIIQSPGKYIQGANAITRLGNYLKPLAERWLIVGDKFVLGFAEEKLRKSLADAGLAAE
IVPFGGECSHNEINRLREIAGAARCNAVLGIGGGKTLDTAKALAHFMNLPVVIAPTIAST
DAPCSALSVIYTDEGEFDSYLMLPRNPNMVIVDTQIVAGAPPRLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALAELCYNTLIEEGEKAMLAAEQHVVTPALEKVIEANTYLSG
VGFESGGLAAAHAIHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPLEEIETVAALCHS
VGLPVTLAQLDIKGDIPGKMRTVAEAACAEGETIHNMPGGATADEVYAALLVADQYGQRF
LHEWE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcattattcaatccccaggcaaatatattcagggcgcgaatgctatcacccgc
cttggcaactatctcaaaccgctggccgaacgctggctcattgttggcgacaagtttgtg
ctgggttttgccgaagaaaagctgcgaaaaagcctggccgatgcgggtctggctgctgaa
atcgtgccgtttggcggtgaatgctcgcataatgaaatcaatcgcttacgcgaaatcgcc
ggcgcagctcgctgcaatgccgtgttgggaatcggcggcggaaaaacgctggataccgcg
aaagcattagcccactttatgaatcttccggtagtgattgccccgaccattgcctcaacg
gacgccccctgcagcgccctctccgttatctataccgacgaaggcgagtttgacagctat
ctgatgctgccgcgcaacccgaacatggtgattgtcgatacgcaaatcgtcgcaggcgct
ccgccgcgcttgctggcagcgggtatcggcgatgcgttggctacctggtttgaagcccgc
gcctgttcacgcagcggcgccacgacaatggccggaggcaaatgcactcaggcggcgctg
gctgagctgtgctacaacacgctgattgaagaaggtgaaaaagcgatgctggcggcggag
cagcatgtcgtcacgccggcgctggaaaaagttatcgaagccaacacctatctgagcggg
gtgggttttgaaagcggcgggctggcagcagcgcatgcgatccataacggccttaccgcc
attccggacgcgcatcactactatcacggtgaaaaggtcgccttcgggacgctgacgcag
ctggtgctggaaaatgccccgctggaagagattgaaaccgtcgccgcgctgtgtcacagc
gtcgggctgcctgtcaccctggcacagctggatattaaaggagatattcccggcaaaatg
cgtaccgtcgcggaagcagcctgcgcagagggagaaactatccacaatatgcccggcggc
gcgaccgctgatgaagtctacgccgcgctgctggtcgccgatcagtacgggcagcgtttt
ctgcatgaatgggaataa

DBGET integrated database retrieval system