KEGG   Raoultella planticola: B1209_26710Help
Entry
B1209_26710       CDS       T05298                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
rpln  Raoultella planticola
Pathway
rpln00860  Porphyrin and chlorophyll metabolism
rpln01100  Metabolic pathways
rpln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    B1209_26710
Enzymes [BR:rpln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     B1209_26710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AUV55772
Position
complement(5527316..5528689)
Genome map
AA seq 457 aa AA seqDB search
MSVQLIDWDLALIQKYNYSGPRYTSYPTALEFSPEFGAAEFDAAVARYPQRPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFAGRQVHQLHWGGGTPTYLNK
AQISRLMRLLRSHFNFNADAEISIEVDPREIELDVLDHLRSEGFNRLSMGVQDFNKEVQR
LVNREQDEAFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLQKVAELNPDRLSVF
NYAHLPTLFAAQRKIKDADLPSAEQKLDILQETIVSLTDAGYQFIGMDHFARPDDELAIA
QRDGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQKELKLYYQQVDETGDALWRG
IALTRDDCIRRDVIKALICQFHLDFSAVETRWKLDFQRYFADDLALLAPLAKDGLVDVDD
KGIQVTAKGRLLIRNICMCFDAYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgcagttaatcgactgggatctggccctgatccagaaatataactattcgggg
ccacgttatacctcataccccaccgcactggagttttcgcctgagttcggtgcggcagaa
tttgacgcggcggtagctcgctacccgcagcgtccgctatcgctgtatgtgcatattccg
ttttgtcacaagctctgctatttctgtggctgcaacaaaattgtgactcgccagcagcat
aaagccgaccagtacctggatgtgctggagcaagaaattattcatcgcgcgccgctcttt
gccgggcgtcaggtgcaccagctgcactggggcggcggtacccccacttacctgaataaa
gcgcaaatcagccgcttaatgcgtttgttgcgcagccatttcaattttaacgccgatgca
gagatctcgattgaagtcgatccgcgtgaaattgaactggatgttctggatcatctccga
tcggaaggctttaaccggttgagcatgggcgtgcaggatttcaataaagaggttcagcgg
ctggtgaaccgcgagcaggatgaggcgtttatctttgccctgctcaaccatgcgcgtgaa
attggttttacctcgacgaatatcgatctgatttacggcctgccgaaacaaacgccggag
agttttgcctttacgctgcaaaaagtggccgagctcaaccccgatcgtctgagcgtattc
aactatgcgcatctgccgacgctcttcgccgctcagcgtaaaatcaaagatgccgacctg
ccttcggcggaacagaagctggatatcctgcaggagaccattgtctcactcaccgacgcc
ggctatcagtttatcggcatggatcactttgcccgtccggatgacgagctggccattgct
cagcgcgacggcgtcctgcaccgtaatttccaggggtacaccactcagggcgataccgac
ctgctggggatgggggtgtcggcgatcagcatgattggcgactgctacgcgcagaaccag
aaagagctgaagctctattatcaacaggttgatgaaaccggagatgcgctctggcgcggt
atcgcgttgacccgcgatgactgtattcgtcgtgacgttattaaggcattgatttgccag
ttccatctcgatttctctgcggtggaaacgcggtggaaactggattttcagcgttatttt
gccgacgatctggcgctgctggcaccgctggcaaaagatgggctggtggatgtggatgac
aagggcattcaggtgacggcaaaaggccgtctgctgattcgcaacatctgcatgtgcttt
gacgcctatctgcgtcagaaagcgcggatgcagcagttctcccgggtaatttaa

DBGET integrated database retrieval system