KEGG   Pararhodospirillum photometricum: RSPPHO_00024Help
Entry
RSPPHO_00024      CDS       T01851                                 

Gene name
bchB
Definition
(GenBank) Light-independent protochlorophyllide reductase subunit B
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00860  Porphyrin and chlorophyll metabolism
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RSPPHO_00024 (bchB)
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     RSPPHO_00024 (bchB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red AP_endonuc_2 RE_Alw26IDE
Motif
Other DBs
NCBI-ProteinID: CCG06650
UniProt: H6SIM3
Position
88452..90038
Genome map
AA seq 528 aa AA seqDB search
MLLTVWTYEGPPHMGAIRVATAMEGVHCVLHAPTGDSYADLLFTMIERGSKRPAVTYSSF
QARDMGGDTATLFKQTVADAYDRFQPQALLVAPTCTGELIQDDPGGLARAVGVPVPVIPL
SLPSYQRKDNWGAAETFYALVRAMAGPTAPPPGTKRVRPAGQAPSCNILGPISLGFRHRD
DVLEVRRLLDGLGVRVNVVAPLGASPADLTRLGEADFNISLYPEVADTAVRWLERTFGQP
TVRTVPIGVGATRDFVAEVAKVAGLEDVPALDEQALRLPWYSRSVDSTYLTGKRVFLFGD
ATHVMACARVAAEEMGFAVVGLGTYSREYGREVRACAQKYGLEALITEDYLEVEARIAEL
RPDLVLGTQMERHVAKRLGVPCAVISAPVHVQDFPARTAPQMGMEGANVLFDTWVHPLMM
GLEEHLLHMFQDDFEFHADASPSHLGGATSRVASEPDVGAPPAAPAAADAPAEPGAPVWD
PDAEAELKKIPFFVRGKARRNTERFAADRGLARITVETLYDAKAHFGS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgacggtttggacctacgagggaccgccccatatgggcgccatccgcgtcgcc
accgccatggagggcgtccactgcgttttgcatgcgccgaccggtgattcctacgccgac
ttgctgttcaccatgatcgagcgcgggagcaagcgcccggccgtgacctacagcagtttt
caggcccgcgacatgggcggcgataccgcgaccttgttcaagcagacggtggccgacgcc
tacgatcgctttcagccccaggccctgctggtcgcgccgacctgcaccggcgagctgatt
caggacgacccgggcgggctggcccgcgcggtgggcgtgccggtgccggtcattcccttg
tccttgccgtcttatcagcgcaaggacaattggggcgccgccgaaaccttctatgccctg
gtgcgggccatggccggccccacggcgccgccgcccggcaccaagcgggttcgcccggcg
gggcaggcgccgtcgtgtaatatcctgggcccgatttccctgggctttcgccatcgcgac
gacgtgctggaagtgcgccgcttgctcgatggtctgggcgtgcgggtcaatgtggtggcg
ccgctgggggccagcccggccgatctgacccgccttggcgaggccgacttcaacatcagc
ctctatcccgaggtcgccgacacggcggtgcgctggctggagcgcacctttggccagccc
accgtgcgcaccgtgccgatcggcgtgggcgccacccgcgacttcgtggccgaggtggcc
aaggtcgccgggcttgaggatgtcccggctcttgatgagcaggccttgcggctgccttgg
tactcgcgctccgtggactccacctacctcacgggcaagcgggtcttcttgtttggtgat
gccacccacgtgatggcctgcgctcgcgtggccgccgaggaaatgggctttgccgtggtc
ggccttggcacctactcgcgcgagtatggccgtgaggtccgtgcctgcgcccagaagtac
ggcctcgaggccctgatcaccgaggattacctggaggttgaggcccgcatcgccgaactg
cgccccgacttggtgctgggcacccagatggaacgccacgtggccaagcgcctgggcgtg
ccctgtgccgtgatcagcgctccggtccacgttcaggacttcccggcccgcaccgccccg
cagatggggatggagggcgctaacgtcttgtttgacacctgggtccatcccctcatgatg
ggcctggaggagcacttgctccacatgttccaggacgactttgaattccacgccgacgcc
tcgccctcgcacctggggggcgcgacgtcgcgcgttgcttccgagcccgacgtcggggct
ccacctgccgcgccggccgccgccgacgctccggccgagcccggggcgcccgtgtgggac
ccggatgcggaagccgagctgaagaagattcccttcttcgttcggggcaaagcccgtcgc
aacacagagcgcttcgcggccgaccgtggcctcgcgcgcatcaccgtcgagacgctgtat
gatgcaaaagcccacttcggaagctga

DBGET integrated database retrieval system