KEGG   Pararhodospirillum photometricum: RSPPHO_00502Help
Entry
RSPPHO_00502      CDS       T01851                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00071  Fatty acid degradation
rpm00072  Synthesis and degradation of ketone bodies
rpm00280  Valine, leucine and isoleucine degradation
rpm00310  Lysine degradation
rpm00362  Benzoate degradation
rpm00380  Tryptophan metabolism
rpm00620  Pyruvate metabolism
rpm00630  Glyoxylate and dicarboxylate metabolism
rpm00640  Propanoate metabolism
rpm00650  Butanoate metabolism
rpm00900  Terpenoid backbone biosynthesis
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01200  Carbon metabolism
rpm01212  Fatty acid metabolism
rpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RSPPHO_00502
   00630 Glyoxylate and dicarboxylate metabolism
    RSPPHO_00502
   00640 Propanoate metabolism
    RSPPHO_00502
   00650 Butanoate metabolism
    RSPPHO_00502
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSPPHO_00502
   00072 Synthesis and degradation of ketone bodies
    RSPPHO_00502
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPPHO_00502
   00310 Lysine degradation
    RSPPHO_00502
   00380 Tryptophan metabolism
    RSPPHO_00502
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RSPPHO_00502
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RSPPHO_00502
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RSPPHO_00502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rpm04147]
    RSPPHO_00502
Enzymes [BR:rpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RSPPHO_00502
Exosome [BR:rpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RSPPHO_00502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CCG07128
UniProt: H6SP56
Position
complement(653445..654767)
Genome map
AA seq 440 aa AA seqDB search
MRHSLLDGGQRPVAGGGLAGCRPFPARRCDQGRPVRRGRRHRSSGPAGSQNSLTRGEHPM
PEAVILAARRTAIGRAGGQFRTLSAPRLMAPVLRALLDDCGLQEAEVDRVIVGNARSGGN
IARACALEAGLPPEVPAVSVDMQCASGLEAILQALWMIQAGAARLILAGGVESTSTAPWM
VERPLSATATPRFMVQTPFCGDAGADSSVVQAAEAMIRACGIDRAQQDAYTAASHTRTLA
AREAGRFDFEIVSVLGGDPEGDEAPRAGLGVDRLARLPPLAAEGTVTTGNSAVPADGAAA
VVVMEATLARALGAPGAMRLIDGVAGGVDPGLSGLGAVPAARRLCRRAGDLGLDSLDQIE
INEVYAGQVLSCLNQLGLGTDTVNPGGGTLALGHPVGAVGALLTVRLFHDLMSAPGRRGA
VLVSSAAGLGLAALFETGAL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcattccctactggatggcggtcagcggcctgtcgctggaggcggtcttgcaggt
tgccgtccttttcctgcccggcgatgtgatcaaggccgtcctgtccggcgtggtcgccgc
caccgttcatcggggcctgccggctctcagaactcgttaacccggggagaacaccccatg
cccgaagcggtcatccttgcggcccggcgcacggccattggtcgtgccggcggtcagttt
cgcaccctctcggcgcctcggctgatggcgccggtcctgcgcgccttgctcgacgactgc
ggcttgcaggaagccgaagtggaccgggtcatcgtgggcaatgcccgctccggcggcaac
atcgcccgcgcctgtgccctggaggccggcctgccgcccgaggtgcccgccgtgagcgtg
gacatgcaatgcgcctcgggtctggaagccatcttgcaagcgctgtggatgatccaggcc
ggggcggcccggttgatcctggctggtggcgttgaaagcaccagcaccgcgccatggatg
gtcgagcgcccgctctcggccacggccacgccacgtttcatggtccaaacgccgttttgc
ggcgatgccggcgccgacagctcggtggttcaggccgccgaagccatgatccgggcttgc
ggcatcgatcgggcccagcaagatgcctacaccgccgccagccacacccgcacccttgcc
gcccgcgaggccggccgcttcgacttcgagatcgtctcggtcctgggcggcgaccccgag
ggcgacgaggcgccgcgggccggcctgggcgtggaccgactggcccgtctacctcccctg
gccgccgaaggcaccgtaaccaccggcaacagcgccgtccccgccgatggcgccgccgcc
gttgtggtcatggaggccaccttggcccgcgccttgggtgcaccgggggcgatgcgcctg
attgatggcgtggccggcggggtggatcccgggctctcgggcctaggcgccgtcccggcc
gcgcgccggctgtgtcgccgggccggcgacctggggctcgacagcctggaccagattgaa
atcaatgaagtgtatgctgggcaggtgctgtcttgcctcaaccagttgggccttggcacc
gacacggtgaatccgggaggcggcaccttggcgttgggccacccggtgggggccgtcggc
gccttgctgaccgttcggttgtttcacgacctgatgagcgctccgggacgacgtggggcc
gtcctggtctccagcgcggccggcctgggtctcgcggccttgtttgaaaccggagccttg
tag

DBGET integrated database retrieval system