KEGG   Pararhodospirillum photometricum: RSPPHO_00563Help
Entry
RSPPHO_00563      CDS       T01851                                 

Gene name
cheB4
Definition
(GenBank) Chemotaxis response regulator protein-glutamate methylesterase 4
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm02020  Two-component system
rpm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RSPPHO_00563 (cheB4)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RSPPHO_00563 (cheB4)
Enzymes [BR:rpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RSPPHO_00563 (cheB4)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     RSPPHO_00563 (cheB4)
Two-component system [BR:rpm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RSPPHO_00563 (cheB4)
Bacterial motility proteins [BR:rpm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RSPPHO_00563 (cheB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: CCG07189
UniProt: H6SPR9
Position
complement(718058..719158)
Genome map
AA seq 366 aa AA seqDB search
MTRVLIVDDSALMRRHLKEILEGAGFETRSARNGTEALEALEADPPDVITLDINMPEMDG
LTCLARLMTVRPTPVVMVSSLTEKGAEATFEALALGAVDFIHKPEGTISLNVARIEREIL
DKVRAASRARIRRSLGLQGRRRAASLQGARKTERPVAQATLDPQSLGVVLVGVSTGGPGT
LEDILPALPADFPWPVVVAQHMPGSFTTVFARRLDTLCALTVIEASSQMPLEPGTVYIAK
GDADVVVGRRATRLVVNPMPSADQYPWHPSVGRLVESALHALPAERLVGVLLTGMGDDGA
AAMTELRQRGGKTIAQDEESSVIFGMPGELVRRGGADVVLPASRIAGQLCGWLGLDKGVH
HGTRQR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgtgttgattgtcgatgattctgccctgatgcgtcgccatctcaaggagatc
ctggaaggggcgggctttgagacacgctcggcgcgcaacggaaccgaggccctggaggct
ctggaagccgatccccccgatgtgatcactctcgacatcaacatgcccgagatggatggc
ttgacctgcctcgcgcggctgatgaccgtgcgccccacgccggtggtgatggtgtcctcg
ctgaccgaaaagggggcggaggcgacgttcgaagccctggctctgggagctgttgatttc
attcacaagcccgagggaacgatctcgctcaatgtggcccgcattgagcgggaaatcctg
gacaaggttcgcgcggcaagccgggcgcggatccggcgctccctgggccttcaggggcgg
cggcgcgcggcctccttgcaaggggcgcgcaagacagaacgcccggtggcgcaggccacc
ttggatccccagtccctgggagtcgtgctggtcggggtctccacgggcgggccgggcacg
ttggaagacattctcccggccctgccggccgacttcccctggccggtggtggtggcccag
cacatgccgggcagcttcacgacggtgtttgcccgccggcttgacacgttgtgtgccctg
acggtgatcgaggcttcgtctcaaatgccgctggaaccgggcacggtctacatcgctaag
ggcgatgccgacgttgtggtggggcggcgggccacccggctggtggtcaaccccatgccc
tcggcggaccagtatccctggcacccgagcgtggggcggctggtggaaagcgccttgcat
gccctgccggccgagcggctggtgggtgttttgctgacgggcatgggggacgacggggcg
gcggcgatgaccgaactgcgccagcgcggtgggaagaccattgcgcaagacgaagagagc
agcgtgatttttggcatgccgggggagttggtgcgacggggaggagccgatgtggttttg
ccggcctcgcgcattgcgggccagctctgtggttggcttggtctggacaagggggtgcat
catgggactcgtcaaaggtaa

DBGET integrated database retrieval system