KEGG   Pararhodospirillum photometricum: RSPPHO_01327Help
Entry
RSPPHO_01327      CDS       T01851                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00010  Glycolysis / Gluconeogenesis
rpm00053  Ascorbate and aldarate metabolism
rpm00071  Fatty acid degradation
rpm00280  Valine, leucine and isoleucine degradation
rpm00310  Lysine degradation
rpm00330  Arginine and proline metabolism
rpm00340  Histidine metabolism
rpm00380  Tryptophan metabolism
rpm00410  beta-Alanine metabolism
rpm00561  Glycerolipid metabolism
rpm00620  Pyruvate metabolism
rpm00625  Chloroalkane and chloroalkene degradation
rpm00903  Limonene and pinene degradation
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_01327
   00053 Ascorbate and aldarate metabolism
    RSPPHO_01327
   00620 Pyruvate metabolism
    RSPPHO_01327
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSPPHO_01327
   00561 Glycerolipid metabolism
    RSPPHO_01327
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RSPPHO_01327
   00310 Lysine degradation
    RSPPHO_01327
   00330 Arginine and proline metabolism
    RSPPHO_01327
   00340 Histidine metabolism
    RSPPHO_01327
   00380 Tryptophan metabolism
    RSPPHO_01327
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSPPHO_01327
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RSPPHO_01327
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSPPHO_01327
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     RSPPHO_01327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCG07953
UniProt: H6SIY8
Position
complement(1611142..1612680)
Genome map
AA seq 512 aa AA seqDB search
MMVPSDLPALAQTLLARLGVPAATTGARLVISPVDGAVLGAVDNTPPEALDALIGRAQAA
FLAWRAVPAPERGALVRLLGEELRRHKDDLGQLVSLESGKILSEGLGEVQEMIDICDFAV
GLSRQLHGLTIASERPGHTLRETWHPLGVVGIITAFNFPVAVWAWNAALALVCGNALIWK
PSERTPLTALASAALLARASVTWAATTGRPVPTDLSSVVIGDARLGQALADDRRVPLVSA
TGSTRMGKALAPRVAARLGRSLLELGGNNAAIVAPSADLDLAVRAITFAAVGTCGQRCTS
LRRLIIHHSVRPALMARLRTVYERLRIGSPLVDGTLVGPLIGADAYQAFEQALEQARAEG
GVVWGGGRVTVPGCEGGFYPRPALVEMPGQTAMMREETFAPILYAVGYDTLDEAIALQND
VPQGLASALFTTDLREAETFLSAEGSDCGIANINIGPSGAEIGGAFGGEKDTGGGRESGS
DAWKAYMRRATNTVNYSHALPLAQGVRFDLQD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgatggtgccgtccgatcttcccgccctcgcccagaccctgttagcccgcctgggcgtc
cccgctgccacgaccggggcgcgcttggtgatctctcccgtcgatggcgccgtccttgga
gccgtggacaacaccccccccgaggccctggacgccctgatcggccgcgcccaggcggcc
ttcctggcatggcgggcggtccccgcaccggagcggggcgccttggtccgtctgctcggc
gaggagcttcgccgccacaaggacgatctcggccaactggtcagcctagaaagcggcaag
atcctctccgaaggcttgggcgaagtgcaggagatgatcgacatctgcgactttgccgtg
ggcctgtcgcggcaactgcacggcctgaccatcgcctccgagcgcccgggccacaccctg
cgcgaaacgtggcatccgctgggggtggtcggcatcatcacggccttcaactttcccgtg
gcggtgtgggcgtggaatgcggcgctggccctggtgtgcggcaatgccctgatctggaag
ccgtccgagcgcacccccctgacggcccttgcctcggcggccctgctggcccgggctagc
gtcacctgggccgcgaccacgggccgaccggtgccgaccgatctgtcaagcgtggtgatc
ggtgacgcccggctgggccaagccctggccgacgaccggcgggtgcctttggtcagcgcc
accggctcgacccgcatgggcaaggccctggcaccccgggtggcggcccgcctggggcgc
tcgcttctggaactgggcggcaacaacgcggccatcgtggcgcccagcgccgatcttgat
ctggcggtgcgggccatcacctttgccgccgttgggacctgcggccagcgctgcaccagc
ttgcgccggctgattatccaccacagcgtgcgtccggccctgatggcgcggttgcggacg
gtctacgagcgcctgcgcatcggttcgcctctggtggacggcaccttggtcggtccgctg
attggcgccgatgcctatcaggctttcgagcaggccctggagcaggcccgcgccgaaggc
ggcgtggtctggggcggggggcgggtgacggtgccgggctgcgagggaggattctatccc
cggccggccctggtcgagatgccgggccaaaccgccatgatgcgcgaggagacctttgcc
ccgattctctatgcggtcggctacgacacgctcgacgaggcgatcgccttgcaaaacgat
gtgccgcaaggactggcctccgcgctgttcaccaccgatctgcgcgaggccgaaaccttc
ctgtcggccgagggcagcgattgcggcattgccaacatcaacatcggcccgagcggtgcc
gagattggcggcgcctttggcggcgagaaggacaccggcggcggccgcgagtcgggctcc
gatgcctggaaggcctacatgcgccgcgctaccaacaccgtcaactactcgcacgccctg
cccctggcccaaggcgtccgcttcgacctccaggactga

DBGET integrated database retrieval system