KEGG   Pararhodospirillum photometricum: RSPPHO_01356Help
Entry
RSPPHO_01356      CDS       T01851                                 

Gene name
r-adh
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00010  Glycolysis / Gluconeogenesis
rpm00071  Fatty acid degradation
rpm00350  Tyrosine metabolism
rpm00625  Chloroalkane and chloroalkene degradation
rpm00626  Naphthalene degradation
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_01356 (r-adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RSPPHO_01356 (r-adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    RSPPHO_01356 (r-adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RSPPHO_01356 (r-adh)
   00626 Naphthalene degradation
    RSPPHO_01356 (r-adh)
Enzymes [BR:rpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     RSPPHO_01356 (r-adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CCG07982
UniProt: H6SJ17
Position
1650533..1651744
Genome map
AA seq 403 aa AA seqDB search
MSSPVFSKKVRTLCALGGSVMAETAFFIPSLNLMGAGCLQGAIAQVRRHGFARALIVTDT
VLNSLGMASQVAKLLADHDIRSCIFDGAQPNPTVGNVEAGLALLQAEHCDCVISLGGGSS
HDCAKGIALTATNGGSIRDYEGVDKSNRAQLPLIAINTTAGTASEMTRFCIITDELRQVK
MAIVDRHVTPLLSVNDPELMLGKPPLLTAATGMDALTHAVEAYVSVAATLITDACALKAV
SIISNTLRTAVAEGSNLAAREAMAYAGFLAGMAFNNASLGYVHAMAHQLGGFYDLPHGVC
NAVLLPHVEAFNADVAASRLKDVAHAMGVDTVGMTDAEGAQACLAAIRRLSADIGIPGGL
TELGVKETDIPVLAANALKDACGLTNPRRADQAEIEAIFRAAA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttccccggttttttcaaaaaaagtgcgcacattatgcgccttaggaggatccgtc
atggctgagaccgcttttttcattccttccctcaacctcatgggggccggctgcctgcaa
ggggcgatcgcccaggtgcgtcgccacggtttcgcccgcgccttgatcgtcaccgatacc
gtgctcaacagtcttggcatggcgagccaggtagccaagctgctcgctgaccacgacatc
aggagctgtatcttcgatggcgcccagcccaaccccacggtcggcaatgtcgaggccgga
ctggccctgttgcaggccgagcattgcgattgcgtgatttcgctgggcggcggctcgtcg
cacgactgcgccaagggcatcgccctgaccgccaccaacggcggctcgatccgcgattac
gaaggggtggacaagtccaaccgggcccagttgcccctcatcgccatcaacaccacggcc
ggcacggccagcgagatgacccgtttttgcatcatcactgacgagttgcgtcaggtgaag
atggccatcgtcgatcgccacgtcacgcccttgctgtcggtcaacgaccccgagctgatg
ctgggcaagccgccgttgctcaccgccgccaccggcatggatgccctgacccacgccgtc
gaggcctatgtgtccgtcgccgcaacgctgatcaccgacgcctgcgccctcaaggccgtg
tcgatcatttccaacaccttgcgcaccgccgtcgccgaagggagcaatctggcggcgcgc
gaggccatggcctacgccggcttcctagccggcatggcgttcaacaatgcgtcgctgggg
tatgtccacgccatggcccaccagctcggcgggttctatgacctgccgcatggggtgtgc
aacgcggtgttgctgccccacgtcgaggccttcaacgccgatgtcgccgcctcccgtctc
aaggacgtggcccacgccatgggggtggacacggtgggcatgacggatgccgagggcgcc
caggcctgcctcgccgccatccgccgcctgtcggccgatatcggcatcccgggcgggctg
accgagttgggggtcaaggaaacggacattccggttctcgccgccaatgctctcaaggat
gcctgtggcttgaccaatccgcgtcgggctgatcaggcggaaatcgaagcgatcttccgc
gcggcggcgtaa

DBGET integrated database retrieval system