KEGG   Pararhodospirillum photometricum: RSPPHO_01892Help
Entry
RSPPHO_01892      CDS       T01851                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00330  Arginine and proline metabolism
rpm00332  Carbapenem biosynthesis
rpm01100  Metabolic pathways
rpm01130  Biosynthesis of antibiotics
rpm01230  Biosynthesis of amino acids
Module
rpm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    RSPPHO_01892 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    RSPPHO_01892 (proB)
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     RSPPHO_01892 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF3093 GreA_GreB
Motif
Other DBs
NCBI-ProteinID: CCG08518
UniProt: H6SKK3
Position
2264260..2265597
Genome map
AA seq 445 aa AA seqDB search
MPASGAGLLLGVGAGAGRGAARPGPSRGRGPRRAPARPGCLGAGVRRPRRRWCRGPHMDT
LTSVCASDILERARRVVLKIGSALLVEASSGMPRRPWLEALVDDIVDLRRGGREVLIVSS
GAVAVGRRSLPLDLTGRPRLQEKQAAAAVGQVRLAHAYQEVLGRHGITAAQVLLTLDDSE
NRRRYLNARNTIDTLLRLGAVPVINENDTVATQEIRFGDNDRLAARVAQMTSADALILFS
DIDGLYTADPNKDPGARFIPTVEALTPEILAMGGGAVTAHGTGGMVTKLAAAAICMEAGC
AMAIAPGKGTNPVKRLREGGRCTWFLPSHEPHAARKSWISGSLRAEGVVTVDEGAARALA
QGGSLLPAGVRAIEGDFQRGAAVRVVGPDGRRLAKGLVSYPAEEARLLMGHKSGEIEALL
GYRGRDELIHRDDMVVDTTEERTAS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcgtccggtgctggccttctcctcggtgtcggggcaggggctggccgaggtgct
gcgcgccctgggccgtcacgtggacgaggcccgcgccgagcgccagcgcgcccaggctgc
cttggcgcaggagttcgacgaccacgacgacgctggtgccgaggaccccacatggacacc
ctgacttccgtctgcgcctccgacatcttggagcgcgcccggcgggtggttctcaagatt
ggctcggccctcctggtggaggccagcagcggcatgccccggcggccgtggcttgaggcc
ttggtggatgacatcgttgatctgcgccggggcgggcgcgaggtgctgatcgtgtcgtcg
ggcgcggtggcggtggggcggcgctcgttgcccctcgatctcaccggccggccgcgcttg
caagaaaagcaggcggcggcggccgttgggcaggtgcgtctggcccacgcgtatcaggag
gtgttgggccgccacggcattaccgccgcccaggtgctgctaaccctcgacgattcggaa
aaccgtcggcgctacctcaacgcccgcaacaccattgataccttgctgcgcctgggcgcg
gtgccggtgatcaacgagaacgacacggtggcgacccaggagatccgctttggcgacaac
gatcgtctggcggcccgggttgcccagatgaccagcgccgacgcgctcatcttgttctcg
gacattgacggtctctacaccgccgatcccaacaaggatccgggggcgcgcttcatcccg
accgtcgaggccctgacgcccgagatcctggccatgggcggcggcgccgtcaccgcgcac
ggcaccggcggcatggtcaccaagctggccgccgccgccatctgcatggaagcgggctgt
gccatggccatcgcgccgggcaaagggaccaacccggtcaagcggctgcgcgagggcggg
cgctgcacgtggtttttgcccagccacgagccccacgcggcgcgcaagtcgtggatctcc
ggctccttgcgggccgagggcgtggtgacggttgatgagggggcggcgcgggccctggcc
caggggggcagtttgctgccggccggggtgcgggccattgagggcgacttccagcgcggc
gccgccgtgcgggtagtggggcccgatggccgccgtctggccaaggggctggtctcctac
ccggccgaggaagcccgcctgctgatgggccacaagagcggtgaaatcgaggccctcctc
ggctaccgtggtcgcgacgaactgatccaccgcgatgacatggtggtggacacgaccgaa
gaaaggactgcctcgtga

DBGET integrated database retrieval system