KEGG   Pararhodospirillum photometricum: RSPPHO_02122Help
Entry
RSPPHO_02122      CDS       T01851                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00020  Citrate cycle (TCA cycle)
rpm00310  Lysine degradation
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01200  Carbon metabolism
Module
rpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPPHO_02122
  Amino acid metabolism
   00310 Lysine degradation
    RSPPHO_02122
Enzymes [BR:rpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RSPPHO_02122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-ProteinID: CCG08748
UniProt: H6SL83
Position
2534938..2535741
Genome map
AA seq 267 aa AA seqDB search
MWCAISRPAQPPPQPRRAPPPPRPRPRPRPARLARARKRSKMTRLRRRVAERLKDAQNTA
AILTTFNEVDMTALMDLRNRYKDTFEKKHGIKLGFMSFFVKACVAALKEIPAVNAEISGD
AILYKNYYDIGVAVGGPQGLVVPVVRDCDALSFAEVEGAIAGYGRKARDGSLTLDEMSGG
TFTISNGGVYGSLMSTPILNPPQSGILGMHKTQMRPMVMPDGSIQARPMMYLALSYDHRI
IDGKEAVTFLVRVKEAIEDPARLLLDV
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcgctatctccaggccggcgcagcccccgccgcagccccgcagagccccgccg
ccgccccgaccccggccccggccccggcccgcgaggctggcccgcgcgaggaaaaggtca
aaaatgacccgcctgcgccgccgcgtggccgagcgtttgaaggatgcccagaacacggcg
gcgatcctgaccaccttcaacgaggtggacatgacggccctgatggacctgcgcaaccgc
tacaaggacacctttgaaaagaagcacggcattaaactgggcttcatgtcgtttttcgtg
aaggcctgcgtggcggcactcaaggaaattccggcggtcaacgccgagatttcgggcgat
gccatcctttacaagaactactacgatattggcgtggccgtgggcgggccgcagggcttg
gtggtcccggtggtgcgcgactgcgacgccctgtcgtttgccgaggtcgaaggtgccatt
gccggctacggccgcaaggcgcgcgacggctcgctgaccctggacgaaatgagcggcggc
acgttcaccatctcgaacggcggcgtctacggctccttgatgtccacccccatcttgaac
ccgccgcagtccggcattctcggcatgcacaagacccagatgcggcccatggtcatgccc
gatggctccatccaggcccgaccgatgatgtacctcgccttgagctacgatcaccgcatc
atcgacggcaaggaagccgtgaccttcctggtccgggtcaaggaagccatcgaggatccg
gcccgcctgctgctggacgtctga

DBGET integrated database retrieval system