KEGG   Pararhodospirillum photometricum: RSPPHO_02512Help
Entry
RSPPHO_02512      CDS       T01851                                 

Definition
(GenBank) Succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00020  Citrate cycle (TCA cycle)
rpm00190  Oxidative phosphorylation
rpm00650  Butanoate metabolism
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01200  Carbon metabolism
Module
rpm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rpm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RSPPHO_02512
   00650 Butanoate metabolism
    RSPPHO_02512
  Energy metabolism
   00190 Oxidative phosphorylation
    RSPPHO_02512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: CCG09138
UniProt: H6SMK3
Position
complement(3019824..3020252)
Genome map
AA seq 142 aa AA seqDB search
MDRRPRRRLTRENVMSLRSSLGRARGLGAAKEGAASHWMAERLPAIALVPLVLWFVFVAI
IPNLGASHAEVVAFMGSPINAALMLLTVLCAFYHGMLGLIVILEDYVQNHTARNVVVFAT
KLYAALGAALATVSILKLSVGG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtggatcgccggcctcgccgccgtctgacaagggagaacgtgatgtctcttcgttcgtct
ctgggccgcgcccggggtcttggtgccgccaaggaaggcgccgcctcgcactggatggcc
gagcgcctgcccgccatcgccctggtgccgttggtgctgtggtttgtgtttgtggcgatc
attcccaacctgggcgcgtctcacgccgaggtggtggctttcatgggctcgcccatcaac
gccgccttgatgctgctgaccgtcctttgtgccttctaccatggcatgctggggctgatc
gtgattctggaggactacgtccagaaccatacggcgcgtaatgtcgtggtgttcgcgacc
aagctgtatgccgccttgggggccgcgctggccaccgtttccatcctcaagctcagcgtc
ggaggctga

DBGET integrated database retrieval system