KEGG   Pararhodospirillum photometricum: RSPPHO_02671Help
Entry
RSPPHO_02671      CDS       T01851                                 

Definition
(GenBank) Tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00260  Glycine, serine and threonine metabolism
rpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01130  Biosynthesis of antibiotics
rpm01230  Biosynthesis of amino acids
Module
rpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RSPPHO_02671
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RSPPHO_02671
Enzymes [BR:rpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RSPPHO_02671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: CCG09297
UniProt: H6SNG6
Position
3201291..3202745
Genome map
AA seq 484 aa AA seqDB search
MFLGSAAYARGNRPESLFAANRDGEALFRLFWAKWLKKCKRRRFIWPSSEGSLLFPRFGG
CAITTAPVRTQGKAMTQTLNTFRSGPDERGRFGPFGGRYVAETLMPLILDLEKAWDSAKN
DPAFQAELDGYLKSYVGRPSPLTLAQRLTEALGGARIYFKREDLNHTGAHKVNNCMGQIL
LARRMGKTRIIAETGAGQHGVATATVCALFGLQCVVYMGATDMARQAPNVFRMKLLGAEV
RPVTSGSGTLKDAMNEALRDWVTNVASTYYLIGTAAGPHPYPAMVRDLQKIIGEETRAQI
QAVEGRLPDTVVACVGGGSNAIGMFHPFLDDPSVRLIGVEAAGEGLDKRHACSMAGGRPG
VLHGNRTYLLQDADGQITEAHSLSAGLDYPGVGPEHAWLKDVGRVEYVPITDDEAVDAFQ
RVTRLEGIIPALESSHAVAHVLKIAPALPRDHLVVVSMSGRGDKDIATVAKAMGAEALLK
EIAS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctcggctctgcggcatacgctcgcggaaatcgcccggaatccttgtttgcggcg
aatcgcgatggagaagctctatttaggctcttctgggcgaaatggttaaaaaagtgcaaa
cggcgccgttttatttggccatcctcggaagggagcctcctctttccccggttcgggggg
tgcgctataaccaccgccccggtgcgcactcaaggaaaagccatgactcagaccctcaat
accttccgcagcggccccgatgaacgggggcggttcggcccgttcggcggccggtatgtg
gccgagactctcatgcccctcatccttgatctggaaaaggcctgggactcggcaaaaaac
gatccggcgttccaggccgagctggatgggtatctcaagagctacgtgggacgcccgagc
ccgctcaccctggcccaacgcctgaccgaggccctgggcggagctcggatctatttcaag
cgcgaagacctcaatcacaccggcgcccataaggtgaacaactgcatgggccagatcctt
ctggcccggcgcatgggcaagacccgcatcatcgccgagaccggtgccggccagcacggc
gtggccaccgccaccgtgtgcgccctgttcggccttcagtgcgtcgtctacatgggcgcc
accgatatggcccgccaagcgcccaatgtttttcgcatgaagctcttgggcgccgaggtg
cggccggtgaccagcggctcgggcaccctcaaggatgccatgaacgaggccctgcgcgac
tgggtgaccaacgtcgcgtccacctattacctgatcggcaccgccgccgggccccatccc
tatcccgccatggtgcgtgacttgcaaaagatcatcggcgaggaaacccgcgcccagatc
caggccgtggaagggcggctgcccgataccgtggtcgcctgcgtcggcggcggctccaac
gccattggcatgttccatcccttcctcgacgatcccagcgtgcgcctgatcggggtcgag
gcggccggcgaaggtctggataagcgccatgcctgctccatggccgggggacggccgggc
gtgctgcacggcaaccgcacctatctgctgcaagatgccgatggccagatcaccgaggcc
cattcgctctccgctggcctcgactatcccggcgttggccccgaacatgcgtggctcaag
gatgtgggccgcgtcgaatacgtgcccatcaccgacgacgaggccgtggacgccttccag
cgcgtcacccgtctggagggcatcatccccgccctcgagagcagccacgccgtcgcccac
gtcctcaagatcgcccccgccttgccacgcgaccacctcgtggtcgtcagcatgagcggg
cggggcgacaaggacatcgccacggtggccaaggccatgggcgctgaagccctgctcaag
gagatcgcgtcgtga

DBGET integrated database retrieval system