KEGG   Pararhodospirillum photometricum: RSPPHO_02789Help
Entry
RSPPHO_02789      CDS       T01851                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rpm  Pararhodospirillum photometricum
Pathway
rpm00010  Glycolysis / Gluconeogenesis
rpm00052  Galactose metabolism
rpm00500  Starch and sucrose metabolism
rpm00520  Amino sugar and nucleotide sugar metabolism
rpm00521  Streptomycin biosynthesis
rpm01100  Metabolic pathways
rpm01110  Biosynthesis of secondary metabolites
rpm01120  Microbial metabolism in diverse environments
rpm01130  Biosynthesis of antibiotics
rpm01200  Carbon metabolism
Module
rpm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RSPPHO_02789
   00052 Galactose metabolism
    RSPPHO_02789
   00500 Starch and sucrose metabolism
    RSPPHO_02789
   00520 Amino sugar and nucleotide sugar metabolism
    RSPPHO_02789
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RSPPHO_02789
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RSPPHO_02789
Enzymes [BR:rpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RSPPHO_02789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CCG09415
UniProt: H6SP90
Position
3341988..3343181
Genome map
AA seq 397 aa AA seqDB search
MSSLGPIPDLDSKVGKVARFARPGQRSLSGEGGRDIRRGTREVRGGPLPRPAPVLASPKG
WTPQRLGRTVMTGLIADIGATNARFALTANGGWRDERIFPCDDFPDFVAAARAYLDATLT
PSEPRPTRAAACLPGPVEGDQVSVTNRPTWSFSRGETAAALGLEAFTVVNDFVANALAVP
HLPAASLVRLDETQAPYTPGAPVAVLGPGTGLGVAVLLPGGREALATEGGHVTLAATTRR
EAQVIAALAEAFGHVSAERAVSGPGLVNLAAAVRRLAGLPAVRRLAGLPAVPNEQPADVM
TDGINGRCPVRAEAVSLFFAFLGTVAGNLVLSTGAWGGVWLMGGILPRCVEPLKASPFVR
RLAGKGRFQDRLEAVPRVLVAHPYPAFVGLAGLVDQP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccctaggcccaatcccggatctggactcgaaggtcggcaaggtagcccggttt
gcgcgccccgggcaacggtccctttcgggggaaggagggcgtgacatcaggcgaggaaca
agagaggtccgaggaggcccacttccccggccggctcctgtgttggcctcgccaaaaggg
tggaccccgcagcgcttaggaaggaccgtcatgaccggactcatcgccgatatcggcgcc
accaatgcccgcttcgccctcacggccaacggcggctggcgcgacgagcggatcttcccc
tgtgacgacttccccgattttgtcgccgctgcccgcgcctacctcgacgccacgctgacg
ccttccgagccccggccaacccgagccgccgcctgcctgcccggtccggttgagggggat
caggtgtcggtgaccaatcgccccacatggtcgttctcccggggcgagaccgccgccgcc
ctggggctggaagcgttcactgtggtcaacgactttgtggccaatgccctggccgtgccc
cacctgccggcggcgtcgctggtgcggcttgacgagacccaggccccttacacgccgggt
gcgccggtggcggtgctgggcccgggaactggcctcggggtggcggttttgctgcccggg
gggcgcgaggccctggcgaccgagggcgggcatgtcaccttggccgccaccacccggcgc
gaggcccaggtgattgccgccctggccgaggcctttggccatgtctcggccgagcgggcg
gtgtcggggccgggtcttgtcaatctagccgccgccgtgcgccgccttgcgggcctgccc
gccgtgcgccgccttgcgggcctgcccgccgtgcccaacgagcagccggccgacgtgatg
accgacgggatcaacggccgctgtccggtgcgggccgaggcggtgtcgctgttttttgcc
tttctgggcacggtggcgggcaatctggtgctctcgaccggggcctgggggggggtgtgg
ctgatgggggggattttgccgcgctgcgtcgaacccctcaaggcctcgccgtttgtccgg
cgtcttgccggcaagggccgctttcaagaccgtctggaggcggtgccccgggtgttggtg
gcccatccctatcctgccttcgtcggccttgccgggcttgttgaccagccatga

DBGET integrated database retrieval system