KEGG   Rickettsia prowazekii NMRC Madrid E: H374_1850Help
Entry
H374_1850         CDS       T02544                                 

Definition
(GenBank) Alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
rpn  Rickettsia prowazekii NMRC Madrid E
Pathway
rpn00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:rpn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    H374_1850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rpn01007]
    H374_1850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rpn03016]
    H374_1850
Enzymes [BR:rpn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     H374_1850
Amino acid related enzymes [BR:rpn01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   H374_1850
Transfer RNA biogenesis [BR:rpn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    H374_1850
 Prokaryotic type
    H374_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1
Motif
Other DBs
NCBI-GeneID: 15149954
NCBI-ProteinID: AGJ01473
Position
complement(214986..217619)
Genome map
AA seq 877 aa AA seqDB search
MTKFTTEEVRSKFITYFKANNHTHVPASSLIPDNDPSLMFVNSGMVQFKNVFTGQEKRSY
NKAVTSQKSLRAGGKHNDLEHVGYTARHHTFFEMLGNFSFGDYFKEQAIYYTWDLLTKEF
ELPKDKLYVTIYHTDDPAASYWKKIAGLKDDRIIRIKTNDNFWSMGDTGPCGPCSEIFFD
HGEEIYGGLPGTKDENCDRFIEIWNMVFMQYEQINKETRIELPKKSIDTGMGLERMTAVL
QHVNNNYDIDLFQEIINFTENIVKIKVDGEAKFSYRVIADHLRASSFLIADGIIPSNEGR
GYVLRRIMRRAMRHAHMLGAKEPLMYKLLPKLVDLMGNIYPELKIAESFISSILEQEEIR
FKTTLERGLKLLTEETKTLTKGSKLSGEVAFKLYDTYGFPLDLTEDILKNRDITVDHKGF
EELMLTQKERARKSWLGSGESKTDQLWFDIKEQYGSTEFLGYTLNEAECKIIALIKNNNL
VDNIQEINTQFLLIANQTPFYGESGGQMGDIGMIFSQGSEIEVIDTFKYLRSIIVHKCIL
KKGKINIGENANLNINIRYRQNLRIHHSATHILHAVLHKILGKQVIQKGSLVTSTYLRFD
INHSKAITNQEITLIEDQVNEIIRNNHEVTTTVMFTEDAIKQGAIALFGEKYDSEVRVVK
IGETSLELCCGTHVKRTGDIGSFKIISESAIAAGVRRIEAVCGEFVIKLIRERDSLLKSI
ESSFKTNKNELITKVINILERNKELEKELEKAHLASLDLSIEQIKKQTKEITGIKLLYKE
VGNINNKILRQAAENLTKKVENLIVVYIAHGVDKLSITVAVSKAITDKFNAGIIAKELSL
FLGGSGGGGQASIAQAGGNDIINLTNINKKLWSLIVT
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatttaccactgaagaagttagaagtaaatttataacttactttaaagcaaat
aatcatactcatgtaccagctagttctttaattccggacaatgaccctagtttaatgttt
gttaattctggcatggtacaattcaaaaatgtttttacaggacaagaaaaaagatcttat
aataaagcagtcactagtcaaaaatctcttagagccggaggcaaacataacgaccttgag
catgtcggttatacagcaagacatcacaccttttttgaaatgctaggtaatttttcattt
ggtgactattttaaagaacaagccatatattacacttgggatttattaactaaagaattt
gagctaccaaaagataagctttatgtaacaatttaccatactgatgatccagcagcttct
tattggaaaaaaatagcaggtttgaaggatgatcgtataatcagaattaaaacaaacgat
aatttttggtctatgggtgatactggtccttgtggaccttgttctgaaatttttttcgat
cacggagaagaaatatatggaggacttccaggtactaaagatgaaaactgcgatagattt
attgaaatttggaatatggtatttatgcaatatgaacaaatcaataaagagactagaata
gagttaccaaaaaaatcaatcgataccggtatgggactcgagcgtatgactgcagtatta
cagcatgttaacaacaattatgacatagatttatttcaagaaataattaattttactgaa
aatatagtaaaaataaaagtagatggagaagctaaattttcttaccgagttatagcagac
cacttacgagcaagcagctttttaatagctgatggcattatcccttcaaatgagggacgt
ggttacgtacttcgtcgaatcatgagacgagctatgcgtcatgctcatatgcttggagca
aaagagccattaatgtataaattattaccaaaacttgttgatttaatgggcaatatttat
cctgaacttaagatagcagaaagttttataagcagcattctagaacaagaagaaattagg
tttaaaactaccttagaacgtggattaaaactccttacagaagagacaaaaacactaaca
aaaggtagtaaattatcaggagaagtagcgtttaaattatatgatacgtatggattccca
cttgatttaaccgaagatattctaaaaaatcgtgatattactgttgaccataaaggattc
gaagagttaatgcttacacaaaaagaacgtgctagaaaatcttggcttggctcaggtgag
tcaaaaactgatcagttgtggtttgatatcaaagagcaatacggtagtacggaattttta
ggatatacacttaatgaagcagaatgtaaaataattgcattaattaaaaataacaattta
gttgataatattcaggaaataaatacgcaatttttgttaattgccaatcaaactcctttt
tacggagaatctggtggtcaaatgggtgacattgggatgatattttcacaaggttctgag
atagaagtaatagatacttttaaatatttacgctctattatagtacataaatgtattttg
aaaaagggaaagattaacataggagaaaatgctaatttaaatataaacataagatatagg
cagaatttaagaattcatcactctgcaacacatatattacacgcagtactgcataaaatt
ctcggtaaacaagttatacaaaaaggttcattagtcacttctacttatttacgctttgat
attaatcattctaaagccataaccaaccaagaaatcactctaattgaagatcaggtaaat
gaaattataagaaacaatcatgaagtaactactacagttatgtttaccgaagacgccatt
aagcaaggagctattgcactattcggtgagaaatacgactccgaagtaagagtagttaaa
ataggtgaaacttctttagaattatgctgcggtacgcatgttaaacgtactggagatatt
ggctcttttaaaattataagcgaaagcgctatagcagcaggtgttcgtaggattgaagcg
gtttgtggtgaattcgtaattaaattaataagagagagagatagtttacttaaatcgata
gaaagcagtttcaaaactaataaaaatgagcttattaccaaagtaatcaatattttagag
cgtaacaaagaacttgagaaagaattagaaaaagctcatttagctagtttagatttaagt
atagagcaaattaaaaagcaaactaaagaaataacaggaataaagctattgtataaagaa
gtaggaaatataaataataaaatattacgtcaagctgccgaaaatctaacaaaaaaagta
gaaaatttaatagtggtatatattgcccacggggttgataaattatccattacggttgca
gtgagtaaagctataacggataaatttaatgcaggtataattgcaaaagaactttcttta
ttcttaggcggcagtggtggaggtggacaagcaagcattgctcaagctggaggaaatgat
ataattaacttaactaacattaataaaaaattatggagcttaatagtaacataa

DBGET integrated database retrieval system